SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044710 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044710
Domain Number 1 Region: 750-916
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.39e-47
Family MAM domain 0.00025
Further Details:      
 
Domain Number 2 Region: 238-329
Classification Level Classification E-value
Superfamily Immunoglobulin 5.92e-17
Family I set domains 0.0051
Further Details:      
 
Domain Number 3 Region: 343-442
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000307
Family I set domains 0.045
Further Details:      
 
Domain Number 4 Region: 438-540
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000445
Family I set domains 0.031
Further Details:      
 
Domain Number 5 Region: 48-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000776
Family I set domains 0.061
Further Details:      
 
Domain Number 6 Region: 535-631
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000134
Family I set domains 0.03
Further Details:      
 
Domain Number 7 Region: 129-217
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000182
Family I set domains 0.028
Further Details:      
 
Domain Number 8 Region: 194-239,632-740
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000541
Family Fibronectin type III 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044710   Gene: ENSBTAG00000005888   Transcript: ENSBTAT00000047505
Sequence length 955
Comment pep:known chromosome:UMD3.1:23:11530878:11594184:-1 gene:ENSBTAG00000005888 transcript:ENSBTAT00000047505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVTCLLLLALIPFHCRGQGVYAPAQAQIMHAGQACVVKEDNISERVYTIREGDTLVLQC
LVTGHPRPQVRWTKTAGSASDKFQETSVFNETLRIERIARTQGGRYYCKAENGVGVPAIK
SIRVDVQYLDEPVLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDIYEPLYTQGETKVLKLKNLRPQDYASYSCQVSVRNVCGIPDKAVSFQLTNTTAPP
ALKLSVNETLVVNPGENVTVQCLLTGGDPLPQLQWSHGPGPLPLGALAQGGTLSIPSVQA
RDSGYYNCTATNNVGNPAKKTVNLLVRSMKNATFQITPDVIKESENIQLGQDLKLSCHVD
AVPQEKVTYQWFKNGKPARMSKRLLVTRNDPELPAVTSSLELIDLHFSDYGTYLCVASFP
GAPVPDLSVEVNISSETVPPTISVPKGRAVVTVREGSPAELQCEVRGKPRPPVLWSRVDK
EAALLPSGLPLEETPDGKLRLERVSRDMSGTYRCQTARYNGFNVRQREAQVQLNVQFPPE
VEPGSQDVRQALGRPVLLRCSLLRGSPQRIASAVWRFKGQLLPPPPAVPVAAEAPDHSEL
RLDAVTRESSGSYECSVSNDVGSAACLFQVSAKAYSPEFYFDTPNPTRSHKLSKNYSYVL
QWTQREPDAVDPVLNYRLSVRQLNQHNALVKAIPVRRVEKGQLLEYILTDLRVPHSYEVR
LTPYTTFGAGDMASRIIHYTEPISSPNLSDNTCHFEDEKICGYTQDLTDNFDWTRQNALT
QNPKRSPNTGPPTDISGTPEGYYMFIETSRPRELGDRARLVSPLYNASAKFYCVSFFYHM
YGKHIGSLNLLVRSRSKGALDTHAWSLSGNKGNVWQQAHVPINPSGPFQIIFEGVRGSGY
LGDIAIDDVTLKKGECPRKQMDPNKVVVMPGSGAPRQPLPQLWGPVATFLLALQR
Download sequence
Identical sequences F1MHX8
NP_001179811.1.59421 NP_001179811.1.76553 ENSBTAP00000044710 ENSBTAP00000044710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]