SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044846 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044846
Domain Number 1 Region: 234-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000051
Family EGF-type module 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044846   Gene: ENSBTAG00000004150   Transcript: ENSBTAT00000047662
Sequence length 701
Comment pep:known chromosome:UMD3.1:27:27732346:27853566:1 gene:ENSBTAG00000004150 transcript:ENSBTAT00000047662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIYSPDMSEGAAERSSSPSTQLSADPSLDGLPAAEDMPETQTEDGRSPGLVGLTLPCCV
CLETERLRGCLNSEKICIVPILACLVSLCLCIAGLKWVFVDKIFEYDSPTHLDPGGLGQD
PIISLDPTAASAAVWVSAKAYTSPVSRAQSETEVRVTVQVDNALGSSEPSAVPTPKNRIF
AFSFRPSTAPSLPSPTRSPDVRTPKAATQPPSTETNLQTAPKLSTSTSTAGTSHLVKCAE
KEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAEELY
QKRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNTMMNVANGPHHP
NPPPENVQLVNQYVSKNVISSEHIVEREAETSFSTSHYTSTAHHSTTVTQTPSHSWSNGH
TESIISESHSVIVMSSVENSRHSSPTGGPRGRLNGLGGPRECNSFLRHARETPDSYRDSP
HSERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSTTVSMPSMAVSPFVEEERPLL
LVTPPRLREKYDHHAQQFNSFHCNPAHESNSLPPSPLRIVEDEEYETTQEYEPAQEPVKK
LTNSSRRAKRTKPNGHIAHRLEMDNNTGADSSNSESETEDERVGEDTPFLAIQNPLAASL
EAAPAFRLVDSRTNPTGRFSPQEELQARLSGVIANQDPIAV
Download sequence
Identical sequences F1MPD0
ENSBTAP00000044846 ENSBTAP00000044848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]