SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044864 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044864
Domain Number 1 Region: 1030-1069
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000585
Family EGF-type module 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044864   Gene: ENSBTAG00000010285   Transcript: ENSBTAT00000047683
Sequence length 1080
Comment pep:known chromosome:UMD3.1:6:36087557:36199876:-1 gene:ENSBTAG00000010285 transcript:ENSBTAT00000047683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGARLFILLSSLWSGGFGLNGPMHTWTTTEDENSQKNATSASVPPNKGQSLQVLPTPKI
TSTEVATAPDSSTSEDSLLKSIPLPSETSASPEGVRKQTLTLTEKTEEGMLKLQTLALQT
EPTLKFSPKAESVILSNSTLKFLQSFARKTNEQGISPNSVGGVGNRSPRETYLSRGDSPG
SQRTSKQKPSFETTRGKNWCAYVHTRLSPTVILDNQVTYVPSGRGPCGWTSGPCPQRSQK
IPNSVYRMQHKIVTSLEWKCCPGFSGPKCQLKAQEQQQLIHSKQAESHAAVGRGTLEQQP
QDCGDPAVTQKMTDQMNYQAVKLALLQKKIDNISLAVSDVRSTYSSLEEKINEDKAGEFK
SFLKGLKSKSINDLVKEIVREQFKIFQNDIEETVAQLFKTVSTVSKELENVRQIIQQVNE
SVISVAVQQKSVLMQENRPTSIDILDLKDHIVNIRQEMTLMCEKPVKELEAKQTRLEDAL
EQERSSRILYYESLNKTLSKMKEVQEHLLSTEQVSNQKTVPIPVSVSNNFTEYVSTLHQN
IKKQGLMLLQISDDLHAQDSKINNLTLALEMEKESVREECEDMLSKYRDGFKVQIKDTEE
NLQVLNQTLIEFLFPMDNKMDKMNEQLNDLTYDMEILQPLLEQGASLRETMTYEQPKEVV
ATKKKVESLTSAVNSLNVLTKELTRRYNLLRNEVQSRGDALERRIDEHALEMEDGLNKTI
TIVNDAIDFIQDNYVLKETLNIIKYNPEIHHKCTQNMDTILTFISQFQHLNDSIQILVND
SQRYNFVLQVAKALAYIPKDEKLRPSNFQKISKMFNETSSQVIKFQQNISHLEEKILSAT
KISKNVETRLQGIESKVTKMLTPYYVSLKKDSAATNESNQALQLQVLNSRFKALEAKSIH
LSINLSLINKTLYEVVTTCHDASRSISELNATIPKRIKDSLPNIQLLQTSLAEYVESVIE
IKTQIALSNLTWYINQSLSSSLANIVKSQKQIKASLKKPNTLKTTVNLTTVQIGRAQRNT
DNILLPVTEEYSYCSRSPCQNGGTCINARTSFICACRHPFTGDNCTVKVAGENALAPVHI
Download sequence
Identical sequences A5PJU2
NP_001095970.1.59421 NP_001095970.1.76553 ENSBTAP00000044864 ENSBTAP00000044864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]