SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044872 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044872
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.08e-19
Family Laminin G-like module 0.00000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044872   Gene: ENSBTAG00000046199   Transcript: ENSBTAT00000047691
Sequence length 295
Comment pep:known chromosome:UMD3.1:11:32130133:32482612:-1 gene:ENSBTAG00000046199 transcript:ENSBTAT00000047691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQ
LTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPS
SMTTESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPVSQTTDDILVASAECPSDD
EDIDPCEPSSGGLANPTRAGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAM
YKYRNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSANKNKKNKDKEYYV
Download sequence
Identical sequences F1MN62
ENSBTAP00000044872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]