SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045008 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045008
Domain Number 1 Region: 1191-1329,1380-1436,1493-1627
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.85e-51
Family Quinoprotein alcohol dehydrogenase-like 0.04
Further Details:      
 
Domain Number 2 Region: 538-816
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.65e-39
Family Quinoprotein alcohol dehydrogenase-like 0.022
Further Details:      
 
Domain Number 3 Region: 373-655
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.59e-27
Family WD40-repeat 0.0025
Further Details:      
 
Domain Number 4 Region: 757-1009
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.41e-26
Family WD40-repeat 0.005
Further Details:      
 
Domain Number 5 Region: 1564-1815
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 8.5e-19
Family SGL-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045008   Gene: ENSBTAG00000033677   Transcript: ENSBTAT00000047843
Sequence length 1817
Comment pep:known_by_projection chromosome:UMD3.1:25:584211:598822:1 gene:ENSBTAG00000033677 transcript:ENSBTAT00000047843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRAGQQQGRGGPPTPMWQQPFLNVFRHFKVDEWKRSTKEGDVAAVTDKTLKCTVYRVRGS
VSASNYIQLPKTSTQSLGLTGRYLYVLFRPLPTKHFVIHLDVSTEDSQVIRVSFSNLFKE
FKSTATWLQFPFICEAGTPREDLPGVASPGARWTCLQLDLHDILLVYLHRCYSHLKGVRL
CASMLVRNLYTSDLCFNPAVTVAEARRAKLPVTPIPREMAFPVPKGESWHDRYVHIRFPS
GSSHVPSKLVQKSGFPPEAVLVGHVPRLLPSPVACSKPARDSRALMVQKHDPEASRWAPS
MPRPLPEVSMSCERSEVSRVAGPGGCTQEPSAWAEATDEHAAGDGLHVSAGQPTVEPAAP
EDAAPHESFLPDPILRLKGVIGFGGHSTKWALWTPDGAAVVYPCHAVVVVLHVETREQRL
FLGHTDKVSALALDGSGSLLASAQARPHSMLRLWDFQTGSCLALFRSPVHTICSLSFSNS
GELLCGVGKDRHGRTTVLVWGVAQLGRGGEAIILAQAHSDADVQVFRVAFFDEARMASCG
RGNVRLWRLRGGVLRSCAVDLGEHHALEFTDLAFGPAQDGHTLYVCSRSGHILEIDHQRM
AVRHARRLLPLQTPRDPLAQKQTFSSGPGIAISSLGVSRSACAVGSEDGYLRLWPLDFSS
VLLEAEHEGPVTSVCVSPGGLRVLSTTSSGHLGFLDVPSQEYHMLVRSHTAPVLALAIER
SRGQLATVSQDRTVRVWDLATLQQLYDFMSPAEAPRAVAFHPTQPTFFCGFSSGAVRSFS
LESAEALVEHRCHRGAITSLAASPDGRFLFSACSRGALAQYHSGAPRCRVLRVAANVVCQ
EACPSSSIMVVSRDSRLLAFVGPSKYTVSVVDTASLDELLKVDVSALDLAGSCLDSAVAL
CFGPSPPSHLLVSMSSNMITVLDARSGRVVRQLSCGHPAACASLSLSADGRFLLTAAERA
VRLWDYATQAGLSCQVYIGHSEPVQAVAFTPDQQQLLSVGDAIFLWDILVPREGWSPGSL
APPSTGPGAGELEGVASGARAPPRQVSVSPPALPPEPGLCAEPPEGFDGEGGGSGRGRLP
HESHGPEDLHQASGPSVLVQKEAGRADDGACGVTGGPWDLGRRPHPCGWPRACSTVGARA
RTLARPDSYRHFTARYKASSLAQGLSLPPAGDEWLRLKAVVGYNGNGRTNLVWSPDTGFF
AYTCGCLVVVEDLHSGAQQHWLGHPEEISTLALSHDAQVLVSASSGSGTASRCQIRLWDV
PRGSCRQLLSHHDSAVQALAFSPDDRLLVTLGDCGDGTLALWSTATCELLSSTRLPEPVH
SMAFSPWHASELACVGRGVLTLQLLWGQAGDVSLQANREPVPEEAGGCELSSLCYGAPPL
LYCGSSEGQVSVWDTRAGRCFLAWEADDGEIGVLLCSGTWLVSGSNTRRLRLWAVGAVSE
LWRRGSGARSSSVFLERELTLDGAVVSAVFHDSMDMGVVGTTAGTLWYVSWAEGTSTRLI
SGHRSKVNDVAFSPNESHCATCSDDGSVRVWCVASTELLIQFQVLSQSCLCLAWSPPSCG
RPEEEHVAAGYSDGTLRVFSIARSAVELKMCPHAAALRALAFSADGQTIISGDKDGLVAV
SRLRTGMTFRVLSDHRGAPICTLQSTRKECGDFGAEGTDLWLAASGDQRVSVWASDWLRD
HCELVDWLSFPAPGLTEVPGCLPPSLAAFCPWDPAVLVCAGLGVYPEVVFYSLRQKQVVE
KIPLPFFAVSMSLCPGAHLVAIGFSERMVRLLDCASGAVQDFAGHDDSVQLCRFAPSAQL
LFTAAHSEILVWEVTGR
Download sequence
Identical sequences F1MAX5
ENSBTAP00000045008 ENSBTAP00000045008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]