SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045258 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045258
Domain Number 1 Region: 160-220
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000164
Family BSTI 0.015
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000045258
Domain Number - Region: 523-584
Classification Level Classification E-value
Superfamily FnI-like domain 0.00439
Family VWC domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045258   Gene: ENSBTAG00000011336   Transcript: ENSBTAT00000048174
Sequence length 674
Comment pep:known_by_projection chromosome:UMD3.1:5:9923408:9960051:1 gene:ENSBTAG00000011336 transcript:ENSBTAT00000048174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYVITTPAGLIIKWTHLTGIVDIHFGSQFNLSSYTEGLCGICNEDPDDDLRMQNGTIITN
MEDIELFIESWEIEKSFKVTTRRPARNCTEQDCSHCIELLNRRVFTPCHDAVSPRDFCEK
MWINYTYFWNHECDALSAYVAVCNKFGICIPWRTPDYCSLTCPEGKEYQPCVRPCEARTC
LNRWFYGHSSCLNLREDCVCKNGTILHRPDSTQCIPEKECACTDSEDQPRTAGEVWNGGT
DECALYKCFANGSIIPIEPECDEQPSPVCEREAEVILGFTDRWTCCSKEVCRCDMTLCET
AIPTCTNSQKLVVGHSPVSCCPQYQCECDPFKCPKISIPECREDQFMIQVQEEETCCFSP
FCVCKPCTEPVPLCTDGEFLTVDLNTTHFCCPQYYCVCEPNLCPMPLFNCAEDMNLVKEN
VSGQCCPTWHCEKDDVCVFQEISVLNPGQSMIRYLEGDFCYMVECLEEKDNHTGFHTLNF
TMVNCSKECDIHQVYTPPPSDYDCCGTCKNISCKFQMENGTTVIYEEGSTWHYNCTTFEC
VKTDEGAMILNYSMVCPPFNETECKMNEGIVKLYNEGCCRICKREERICQKVIIKSVIRK
QDCISQSSINVASCDGKCPSATIYNINIESHLRFCKCCRENGVRNLTVPLYCSGNGTEVL
HTLQEPMDCTCQWN
Download sequence
Identical sequences E1BBP9
9913.ENSBTAP00000045258 ENSBTAP00000045258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]