SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045291 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045291
Domain Number 1 Region: 1172-1354
Classification Level Classification E-value
Superfamily AbfB domain 7.72e-28
Family AbfB domain 0.0089
Further Details:      
 
Domain Number 2 Region: 734-791
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000054
Family BSTI 0.041
Further Details:      
 
Domain Number 3 Region: 1778-1838
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000719
Family BSTI 0.015
Further Details:      
 
Domain Number 4 Region: 832-900
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000883
Family ATI-like 0.025
Further Details:      
 
Domain Number 5 Region: 377-436
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000114
Family ATI-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045291   Gene: ENSBTAG00000011336   Transcript: ENSBTAT00000048210
Sequence length 2283
Comment pep:known_by_projection chromosome:UMD3.1:5:9787259:9959753:1 gene:ENSBTAG00000011336 transcript:ENSBTAT00000048210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPWSIFLLHILLFSLQGYICTSSILTRTSENRFNENLQKRALLAAQFEATSPRYFFHEA
INWGESKIKGSCPHECLNGAFCSKAGTCDCQIFQALGTRCQIVPNMGNGRDGICKTWGQY
HFETFDGIYYYFPGNCSYIFAKDCGNLEPQYTVWVHNSPKCLGSVYYCYRSISLFFSDQE
EIQIYGHEIKKNGISLTLPQTIGQVFIEKLADYILVKTTFGFSLAWDGISGVYLKLSEEH
KGKSCGLCANYNGIQSDDFIIQQEDYTEDIAVFANTWSVQTPDDTKCVPTPSDFPNPCSS
GMPAFEAIFFKCQILLQFPFLSCHEYIDPYLYIASCVNDLCKTHDDETYCRAATEYARAC
SHAGYPIQDWRDDFPACIDKCDDSFVHRDCISCCPPTCTFEKQCLGSNLHCLDGCYCPDG
LIMENGTCISLENCPCNFHGLAYSVGSKIEQECTECVCVGGVWNCTEHDCPVQCSIVGDS
HFMTFDGRHYSFIGMCQYILVKGTGKDKFTITLQKAHCEQNLGLVCLQSVTLILEDDFNK
QVTLSRGGQILTSPNQGFSLNGIVEIQTLSSLFILLKTTFGLKILFTVDGERIYIQLTSA
WKRRTLGLCGTFNGNIRDDFLSPSGMIEVTPQLHANAWRVSSTCFAPVHVPVVDPCNINQ
QNIGYAAHCDVIYQELFAPCHIYISPGLYYQLCRHDACKCGSACLCNALAHYAYLCGQRG
IPIDFRAQVSFCGVVCQKGMMYHHCSSFCRRSCVSLSAPEQCNDDCAEGCNCPEGKYYED
TLSFCVPIFHCRCHYRGSIYQPGELIPTPSGLCQCSNGTVKCDELATPSTVHICPEGKQY
FDCRFPDPQLPAGGINCETTCANLAMNFTCAPSSPCISGCVCAPGMAEHKGKCYIPESCP
CIWKDWEYLSGEVIATPCYTCVCRRGMFNCTYYPCPAVCTIYGDRHYHSFDGLEYDYISD
CQVFLIKSTDDSDISVIAQNKKCFDNDIVCSKSVLISVGATEIYLNDSPYKQKRSGFFLE
NKPTYQLWKAGYYMVVYFPEKDITILWDKKTTIHIKVGPWWKNKLSGLCGNFDKCTSNDM
TTSNNLEVRNAQVFGDSWALGQCKTPVESFKPCEAHQNKFPYAKKECSILYSDAFASCRN
VIDVTSFAKNCHEDTCNCNLGGDCECLCTSIAAYAYKCCQEGVSVHWRSPTLCSLDCEYY
NEGLGEGPYMLASYGQTGLILGANITSGSIFSLPRSSIRGSLFFNFMITPGLFKEKASSL
ALVSLESAERPNYFLCVHDDDTLSLKLWEANSAFHRRATFFHHQDLWIPGYSAFELYSKK
GFFIILTDSSAKASKYDDSEEFKRLSSFSVEEIQAAVPYRRMCEWKYEPCATPCFKTCGD
PAALACKFLPPIEGCFPYCPKHMILDEVTLKCVYPEDCIPLIPTEPALISPDFTAIDMLT
TTTGLECEPQQFDPVYNCSQYICLNMEWKLYNWSLNCPKDLEMPDCGFRGRPVQVNSDIC
CPEWECPCRCSMLSELSIITFDGNNAALYSMASYILVRIPGEVIVAHIEKCSMNQNGNSF
KKLASSGRVSGLCFKKLNLTTSLHKVLVNRVARKVEVDSAVVPLPFSNQDLSIEDSGSMY
VITTPAGLIIKWTHLTGIVDIHFGSQFNLSSYTEGLCGICNEDPDDDLRMQNGTIITNME
DIELFIESWEIEKSFKVTTRRPARNCTEQDCSHCIELLNRRVFTPCHDAVSPRDFCEKMW
INYTYFWNHECDALSAYVAVCNKFGICIPWRTPDYCSLTCPEGKEYQPCVRPCEARTCLN
RWFYGHSSCLNLREDCVCKNGTILHRPDSTQCIPEKECACTDSEDQPRTAGEVWNGGTDE
CALYKCFANGSIIPIEPECDEQPSPVCEREAEVILGFTDRWTCCSKEVCRCDMTLCETAI
PTCTNSQKLVVGHSPVSCCPQYQCECDPFKCPKISIPECREDQFMIQVQEEETCCFSPFC
VCKPCTEPVPLCTDGEFLTVDLNTTHFCCPQYYCVCEPNLCPMPLFNCAEDMNLVKENVS
GQCCPTWHCECSCENLVMPSCEVGEFTAIDYNFQSDCGCVQYLCEKDDVCVFQEISVLNP
GQSMIRYLEGDFCYMVECLEEKDNHTGFHTLNFTMVNCSKECDIHQVYTPPPSDYDCCGT
CKNISCKFQMENGTTVIYEEGSTWHYNCTTFECVKTDEGAMILNYSMVCPPFNETECKMN
EGIVKLYNEGCCRICKREERICQKVIIKSVIRKQDCISQSSTLHLAMENAHQPPYITSIL
RAI
Download sequence
Identical sequences F1N5T7
ENSBTAP00000045291 ENSBTAP00000045291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]