SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045403 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045403
Domain Number 1 Region: 47-178
Classification Level Classification E-value
Superfamily L domain-like 1.43e-18
Family U2A'-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045403   Gene: ENSBTAG00000034091   Transcript: ENSBTAT00000048342
Sequence length 288
Comment pep:novel chromosome:UMD3.1:4:24990980:25050993:1 gene:ENSBTAG00000034091 transcript:ENSBTAT00000048342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARDPSHLPRACRPPAIPVRVAEAALEISRTAIEEQLKICGHKKDADVFELFLSQKELTE
VIDLSRFKKLKYLWLHHNKLRKVIFLTSNHFLLEIYINHNTIVEIEKMHLVPSLHGLLLG
RKVMTNLDSIFKSMEGKKELKNLTLYQNPLCQYNLYRLYIIYHLPGVELLDRNQVTEKER
RSMITLFNHKKAHIVQSIAFRGKVDASWDPRSPFKQKPAQRVPSDFAFANNVDKTMFDDP
EDAVFVRSMKRSAMAITSLNWDTVPTREEKYLEEKDTGPAQMLTITLR
Download sequence
Identical sequences G3X7X5
ENSBTAP00000045403 ENSBTAP00000045403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]