SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045501 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000045501
Domain Number - Region: 84-208
Classification Level Classification E-value
Superfamily L domain-like 0.0068
Family L domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045501   Gene: ENSBTAG00000034196   Transcript: ENSBTAT00000048473
Sequence length 494
Comment pep:known_by_projection chromosome:UMD3.1:14:10106503:10127283:1 gene:ENSBTAG00000034196 transcript:ENSBTAT00000048473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGFLLRGPLVRLCLDLTCVLSLFNTVSSFRGEAEKENVMTFLPTTASGNKQVKKEKDGT
WLGATVSSLREEERREKGIVFLDTTELPARSVDLSALNLTELVNGMLNRALKDSKNFFSL
LSVTSYSSFAFHKFSVAIYNISNLKTVDPANFPTRYCYCLNNQTNDLSDFTALLVDIIGN
SSSHLTEMFKSASILSVSQTNESDCIFICMMTGKSGRNLSDFWELVEKSPVINYTFTSNI
SGVLGAATTASALTSQLTPTSQQTLPRTSPPRGAQRAGVSALRTSSGTDTTPPSEAEQTL
KTNVLPECHSRATTTRKVARTPRVTAHRQAQASTLPTPWAQVTSEKTPGGPPWETLASLP
TSPKAEETMNTRSLSQPPAGTAAAVGSPIQTSPTSGPSTPGTQTPSPTKAPAPKYPQAGD
LPAVWTFIPGEESALIPGTHQFSRCPEPLPKEGAMTAAPLALTVQKLNPCLMELCRFFQQ
CLCTSQKSEPRMEA
Download sequence
Identical sequences E1B8K3
ENSBTAP00000045501 9913.ENSBTAP00000045501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]