SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045522 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045522
Domain Number 1 Region: 19-153
Classification Level Classification E-value
Superfamily L domain-like 1.16e-29
Family U2A'-like 0.035
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000045522
Domain Number - Region: 325-390
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.00194
Family Nuclear movement domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045522   Gene: ENSBTAG00000010548   Transcript: ENSBTAT00000048498
Sequence length 472
Comment pep:known chromosome:UMD3.1:14:9657203:9728203:1 gene:ENSBTAG00000010548 transcript:ENSBTAT00000048498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRITEDLIRRNAEHNDCVIFSLEELSLHQQEIERLEHIDKWCRDLKILYLQNNLIGKIE
NVSKLKKLEYLNLALNNIEKIENLEGCEGLTKLDLTVNFIGELSSVKTLQGNIHLKELFL
MGNPCADFDGYRQFVVATLQQLKWLDGKEIERSERIQALQNLPVVEQRIREQEKAYCLKR
AKDKEEAQRKLEEEESKGEMGRSHTGSGGHWHADLSATLPSFEESKDYIQAPEIEEGQCK
GKEFDDREDDLEFWNKPSLYTPESRLETLRHMEKQRRDQERLSEKKKKVKPPRMLVTEDG
RALNVNEPKLDFTLKDDEKRNQIVLDLAVYRYMDTSLIDVDVQPTYVRVMVKGKPFQLIL
PAEVKPDSSFAKRSQTTGHLVVCMPKVGEVIIGCQRTSKPVKSTPDSSKEQTSKSQQMER
LEVDPSKRSIPDVANIVQEKKHMPRRVCAEPKIIPSEEDPDFEDNPEVPPLI
Download sequence
Identical sequences Q1RMR5
ENSBTAP00000045522 ENSBTAP00000045522 NP_001069372.1.59421 NP_001069372.1.76553 9913.ENSBTAP00000045522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]