SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045584 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045584
Domain Number 1 Region: 66-256
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.19e-51
Family Astacin 0.00012
Further Details:      
 
Domain Number 2 Region: 426-592
Classification Level Classification E-value
Superfamily TRAF domain-like 1.96e-35
Family MATH domain 0.0011
Further Details:      
 
Domain Number 3 Region: 264-427
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-31
Family MAM domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045584   Gene: ENSBTAG00000020391   Transcript: ENSBTAT00000048571
Sequence length 700
Comment pep:known_by_projection chromosome:UMD3.1:24:25292754:25328875:-1 gene:ENSBTAG00000020391 transcript:ENSBTAT00000048571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSWYLPWFLCSAALLLVSGMPTPEIFDVDNGLDRDIFDINEDLGLDLFEGDIILDEIQE
RNAIIGERYRWPHTIPYVLDDSLEMNARGVILKAFERYRLKSCIDFKPWSGEPNYISVFK
GNGCWSSVGKQLTGIQELSIGEGCDKIATVQHEFLHALGFWHEQSRSDRNDYVSIIWNRI
ISGKERNFDFYDDQVIDSMNVPYDYSSVMHYGKTAFGNGSEPTIVTRVPDFMDVIGQRMD
FSDSDVLKLNQLYNCSSSLSFMESCDFELGNVCGMIQSSADSADWQRLSEVSEGPESDHS
NMGRCRGSGFFMHFNSSSVNEGATAILESRILYPKRGFQCLQFFLYNSGSEDDQLNIYIR
EYSTAHLSRTLTLVEQIKDIPSGSWQLYHVTLNATNKFRVVFEGVRGAGASLGGLSIDDI
NLSETRCPHHVWHIRNFTQLIGSPNGSFYSPPFYSSKGYAFQIYLNLDSLPKIGMYFHLI
SGANDDHLEWPCPWQQVTITILDQTPDIRQRMSKQQSLTTDPFLTIDNGNYFWDRPSKVG
AQVIFPNGTQFQRGRGRGFPNFMSQEMLKSRDFIKGDDVYILLTVEDISHLNTQNDPLPT
LNVNDLCTSFRCENDGICILQNGKAECRCRSGDDWWYMGERCEKRGSTRDTIVIATSSTA
AVFALMLIITLVSVYCTRKKYRKEPSSRTVNTIMENQYAL
Download sequence
Identical sequences E1B7B4
ENSBTAP00000045584 NP_001137570.1.59421 NP_001137570.1.76553 ENSBTAP00000045584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]