SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045818 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045818
Domain Number 1 Region: 14-218
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-55
Family SPRY domain 0.00000000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045818   Gene: ENSBTAG00000019783   Transcript: ENSBTAT00000048850
Sequence length 268
Comment pep:known chromosome:UMD3.1:5:103939886:103942299:1 gene:ENSBTAG00000019783 transcript:ENSBTAT00000048850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQTALAGGSSDPSTPQALYPDRSRPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVK
EGGLCFERRPVAQSTDGARGKRGYSRGLHAWEISWPREQRGTHAVVGVATARAPLQADHY
AALLGSNSESWGWDIGRGKLYHQSKGPGAPQYPPGPQGEPLEVPERLLVVLDMEEGTLGY
AVGGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRINYLGERRGEAWDGCGASVRSLVAVVW
DGCSAPYNHRGNGPSSDWSATQFSARIG
Download sequence
Identical sequences L8HVB3 Q17QZ2
ENSBTAP00000045818 ENSBTAP00000045818 9913.ENSBTAP00000045818 NP_001069748.1.59421 NP_001069748.1.76553 XP_014337566.1.15283 XP_015326796.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]