SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045833 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045833
Domain Number 1 Region: 358-610
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.19e-70
Family Eukaryotic proteases 0.00079
Further Details:      
 
Domain Number 2 Region: 150-252
Classification Level Classification E-value
Superfamily SRCR-like 4.84e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0088
Further Details:      
 
Domain Number 3 Region: 294-329
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 258-291
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000511
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 5 Region: 85-145
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000427
Family Ovomucoid domain III-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045833   Gene: ENSBTAG00000034501   Transcript: ENSBTAT00000048867
Sequence length 618
Comment pep:known chromosome:UMD3.1:6:16765034:16815352:1 gene:ENSBTAG00000034501 transcript:ENSBTAT00000048867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLGHVILLLLCFYLSFCEDNFRKRGKSKAVKKSEAHHAPEASLSKETEASSEVKPTSTQ
DTSQKDFVDKKCLTEKHTHLSCNKVFCQPWQKCIDGTCLCKLPYQCPKNGTRVCSTNGKS
YSTYCQQKSFECYRPEAKFLKSGACTGGGQFSVSLSNGKQDSEGIVAVKLADLDTKMFVC
GDSWSITEANVACIDRGFQLGALDTHRRDPDPNSAECLHVRCRGLETSLAECTFTKGVHN
SEGLAGVVCYTESAAPPKKDSFQCVNGKRIPQKKACDGVNDCVDKSDELCCKDCRGEGFL
CKSGVCIPKQYKCNGELDCITGEDEVGCEETGHPEIKEAAEMLTADMDAERKFTKSFLPK
LSCGVKNNMHIRRKRVVGGKPAKMGEFPWQMAIKEGDKIHCGGIYIGGCWILTAAHCVRI
SRMHRYQIWTSFTDWLRPGFQTVVHSVNRIIIHENYNGTTYQNDIALIEMKKRPNEKECV
LSKSIPACVPWSPYLFQPNDKCIVSGWGREKDNQKVYSLRWGEVHLINNCSEFYPGRYFE
KEMQCAGTDDGSIDACKGDSGGPLVCQDVNNVTYVWGVVSWGENCGKSEFPGVYTKVANY
FDWISQHVGRSLISQHNI
Download sequence
Identical sequences F1N4M7
ENSBTAP00000045833 ENSBTAP00000045833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]