SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045916 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000045916
Domain Number - Region: 84-147
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.0968
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045916   Gene: ENSBTAG00000016758   Transcript: ENSBTAT00000048965
Sequence length 233
Comment pep:known chromosome:UMD3.1:22:10492112:10499846:-1 gene:ENSBTAG00000016758 transcript:ENSBTAT00000048965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHNHSFVGCVNPQWALAQHQTKLYLLNTTRLSEELFYQILVYDFANFGVLRLSEPAPLF
DLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLVGLPLLI
DNYVPPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIRKQYVSAESTLSGQQSE
VPGSTANPWKWTVEHVIYKAFRSHLLPPKHFTEDGNILQLANLPDLYKVFERC
Download sequence
Identical sequences Q1RMN2
ENSBTAP00000045916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]