SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046207 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000046207
Domain Number 1 Region: 55-164
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-24
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 2 Region: 250-356
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.15e-19
Family Platelet-derived growth factor-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046207   Gene: ENSBTAG00000034827   Transcript: ENSBTAT00000049292
Sequence length 364
Comment pep:known chromosome:UMD3.1:15:4501435:4788300:1 gene:ENSBTAG00000034827 transcript:ENSBTAT00000049292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRLVLVYTLVCANFCSYRDTSATPQSASIKALRNANLRRDDLYRRDETIEVTGHGHVQS
PRFPNSYPRNLLLTWRLHSQEKTRIQLAFDNQFGLEEAENDICRYDFVEVEDISETSTVI
RGRWCGHKEVPPRIISRTNQIKITFKSDDYFVAKPGFKIYYSFVEYFQPAAASETNWESV
TSSISGISYHSPSVTDPTLTADALDKTIAEFDTVEDLLKHFNPESWQEDLENLYLDTPHH
RGRSYHDRKSKVDLDRLNDDVKRYSCTPRNYSVNLREELKLTNVVFFPRCLLVQRCGGNC
GCGTVNWKSCACNSGKTVKKYHEVLKFEPGYFKRRGRAKHMALVDIQLDHHERCDCICSS
RPPR
Download sequence
Identical sequences A4IFC0
9913.ENSBTAP00000046207 NP_001077175.1.59421 NP_001077175.1.76553 ENSBTAP00000046207 ENSBTAP00000046207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]