SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046313 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000046313
Domain Number 1 Region: 308-522
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-44
Family SPRY domain 0.00011
Further Details:      
 
Domain Number 2 Region: 30-141
Classification Level Classification E-value
Superfamily Immunoglobulin 2.04e-20
Family V set domains (antibody variable domain-like) 0.00012
Further Details:      
 
Domain Number 3 Region: 148-230
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000176
Family C1 set domains (antibody constant domain-like) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046313   Gene: ENSBTAG00000034945   Transcript: ENSBTAT00000049419
Sequence length 543
Comment pep:known chromosome:UMD3.1:23:25634655:25643394:-1 gene:ENSBTAG00000034945 transcript:ENSBTAT00000049419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCSPVFSLLRDLFLILLFQMSMRGSDSFSVTGPSEPIVAMLGADTVLPCRVYPAMNVEN
MEIRWFRNQFSEAVFVYQNGMEQVGEQLVDFKGRAELVKDYITEGRVAVRIHSLRVSDNG
MYKCFFKKGTDFEEAVLELKVIGIGSGPRVFLVGPEDGGIRLKCTGKGWFPQPEVQWEDV
KGKKIPSVSEDETQDDDGLFQIEASLIVRDSSTTQMSCSMKNPFFGQEQAETIFIPESFF
PRPSPWKAAFAVTLVILGVSAGAIVYLAWKERQGKKKLSKVEEEKKKESTSKESFKRELA
RRKELYQQDWRKAELYADWRKEQFKAAAFTLDPKTAHPNLVLSENKQHISLKNNVSQNGD
ASTHEDQAVSEAIFSVLGDKSFTQGDTERQYWEVEVNTRTEAGSTTRCALGICSETVKRE
GWFVESPDKNFWVLVHEEGKVVFPNSQKNSPSLRQQPRRIGVFLDWEVGNLSFYNMADGS
HIYSFTGVTFCGTLFPYFSLRGTGASLTICSTSDHPEHCPDSSPKTSLTHLSSSVPQEAN
SLL
Download sequence
Identical sequences A2VE28
NP_001075192.1.59421 NP_001075192.1.76553 ENSBTAP00000046313 9913.ENSBTAP00000043540 9913.ENSBTAP00000046313 ENSBTAP00000046313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]