SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046486 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000046486
Domain Number 1 Region: 92-299
Classification Level Classification E-value
Superfamily L domain-like 4.47e-42
Family Ngr ectodomain-like 0.00024
Further Details:      
 
Domain Number 2 Region: 319-525
Classification Level Classification E-value
Superfamily L domain-like 3.61e-38
Family Ngr ectodomain-like 0.0000411
Further Details:      
 
Domain Number 3 Region: 960-1148
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.07e-35
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 4 Region: 539-675
Classification Level Classification E-value
Superfamily L domain-like 1.59e-29
Family Ngr ectodomain-like 0.0034
Further Details:      
 
Domain Number 5 Region: 2-61
Classification Level Classification E-value
Superfamily L domain-like 0.000000000156
Family Ngr ectodomain-like 0.0047
Further Details:      
 
Domain Number 6 Region: 815-857
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000152
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 889-929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 8 Region: 773-813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000348
Family EGF-type module 0.013
Further Details:      
 
Domain Number 9 Region: 853-892
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000512
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 10 Region: 732-772
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000147
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 11 Region: 1232-1261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000994
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046486   Gene: ENSBTAG00000017746   Transcript: ENSBTAT00000049620
Sequence length 1339
Comment pep:known chromosome:UMD3.1:20:324518:507045:-1 gene:ENSBTAG00000017746 transcript:ENSBTAT00000049620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGPFTLCMAPV
HLRGFNVADVQKKEYVCSGPHSEPPACNANSISCPSACTCSNNIVDCRGKGLTEIPANLP
EGIVEIRLEQNSIKSIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSLVLYGNK
ITEIPKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQSLSLLSLYDNKLQTISKGLFAPL
QAIQTLHLAQNPFVCDCHLRWLADYLQDNPIETSGARCSSPRRLANKRISQIKSKKFRCS
GSEDYRSRFSSECFMDLVCPDRCRCEGTIVDCSNQKLARIPSHLPEYVTDLRLNDNEISV
LEATGIFKKLPNLRKINLSNNRIKEVKEGAFDGAASVQELVLTGNQLETAHGRAFRGLSG
LKTLMLRSNLISCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINLLSNPFN
CNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNDESSCQLGPRCP
EQCTCVETVVRCSNRGLRALPKGIPKDVTELYLEGNHLTAVPKELSSFRHLTLIDLSNNS
IGMLTNYTFSNMSHLSTLILSYNRLRCIPVHSFNGLRSLRVLTLHGNDISSVPEGSFNDL
TSLSHLLLHTFPMNYNSSICQLSRYITPFNGYSEFQISGCSKVTPKNFLDELILASYIHR
NLPPGPVDIGIVAKCDPCLSSPCKNNGTCSQDPVEGHRCACSHGYKGRDCTVPMNTCIQN
PCLHGGTCHLSETHKGGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGVNNYVCVC
PPNYTGELCDEVIDHCVPGMNLCQHEAKCISLDRGFRCECPPGYSGKLCEVDDDDCAAHR
CRHGAQCVDAVNGYTCICPQGFSGLHCEHPPPMVLLQTSPCDQYECQNGQCIVVQQEPTC
RCPPFAGPRCEKLITVNFVGKDSYVELASAKVRPQANISLQVATDKDNGILLYKGDNDPL
ALELYQGHVRLVYDSLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPKSLGK
LQKQPAVSINSPLYLGGIPTSTGLSALRQGMDRPLGGFHGCIHEVRINNELQDFKALPPQ
ALGVSPGCKSCSVCRHGLCRAVEKDSVVCECHPGWTGPLCDQEARDPCLGHSCIQGKCVA
SGTSYVCRCTEGYGGALCDQKNDSNSACSTFKCHQGQCHVSDRGEPYCLCRPGFSGEHCE
QETPCLGEVVREVIRRQKGYASCATASKIPVMECRGGCGPQCCQPTRSKRRKYVFQCTDG
SSFVEELERHLECGCRPCS
Download sequence
Identical sequences F1MMM6
ENSBTAP00000046486 ENSBTAP00000046486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]