SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046571 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000046571
Domain Number 1 Region: 49-274
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.55e-73
Family Lectin leg-like 0.00002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046571   Gene: ENSBTAG00000003975   Transcript: ENSBTAT00000049716
Sequence length 348
Comment pep:known chromosome:UMD3.1:11:2653390:2672003:-1 gene:ENSBTAG00000003975 transcript:ENSBTAT00000049716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVALGPSGWWQRWRRRLSAREVSRMLLLLLLLGSGQGPRQVGAGQTFEYLKREHSLSKP
YQGVGTSSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFRIHGQ
GKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQERVFPYISAMVN
NGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEV
PGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLP
EMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQDQSRKRFY
Download sequence
Identical sequences Q2HJD1
XP_005212405.2.76553 XP_005891680.1.15283 XP_019825271.1.53367 ENSBTAP00000046571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]