SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046844 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000046844
Domain Number 1 Region: 1578-1820
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.57e-54
Family Ankyrin repeat 0.00000132
Further Details:      
 
Domain Number 2 Region: 476-591
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000314
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 350-477
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000643
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 155-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000817
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 586-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000119
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 6 Region: 929-966
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000401
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 7 Region: 967-1010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000444
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 8 Region: 275-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000456
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 763-803
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000062
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 10 Region: 102-235
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000879
Family Growth factor receptor domain 0.0075
Further Details:      
 
Domain Number 11 Region: 808-933
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000785
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 12 Region: 234-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000104
Family EGF-type module 0.019
Further Details:      
 
Domain Number 13 Region: 690-728
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000135
Family EGF-type module 0.015
Further Details:      
 
Domain Number 14 Region: 1252-1283
Classification Level Classification E-value
Superfamily Notch domain 0.000000157
Family Notch domain 0.0024
Further Details:      
 
Domain Number 15 Region: 728-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family EGF-type module 0.015
Further Details:      
 
Domain Number 16 Region: 1005-1047
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000529
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 17 Region: 1046-1090
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000201
Family EGF-type module 0.01
Further Details:      
 
Domain Number 18 Region: 311-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 19 Region: 1215-1245
Classification Level Classification E-value
Superfamily Notch domain 0.0000112
Family Notch domain 0.0065
Further Details:      
 
Domain Number 20 Region: 29-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000015
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046844   Gene: ENSBTAG00000025424   Transcript: ENSBTAT00000050083
Sequence length 1994
Comment pep:known_by_projection chromosome:UMD3.1:23:26973191:26998620:1 gene:ENSBTAG00000025424 transcript:ENSBTAT00000050083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPSLLLPLLLLLCQPVVRTRGLQCGSFPEPCANGGTCLSLSQGQGTCQCAPGFLGETC
QFPDPCQDAQPCQNGGSCHTFLPTLPGSPGTPSPMAPSFFCTCPSGFTGDRCQAQIRDPC
SSFCSKMGRCHLQDSGRPRCSCMPGWTGEHCQLRDFCSANPCVNGGVCLATYPQIQCRCP
PGFEGHACEHDVNECYLDPGPCPKGTTCHNTLGSCQCLCPAGREGPRCGLRPGPCTPRGC
LNGGTCQLVPGRDSTFHLCLCPPGFTGPSCEVNPDDCAGHQCQNGGTCQDGLGTYTCLCP
EAWTGWDCSEDVDECEVQGPPRCRNGGTCQNSAGDFYCVCVSGWGGAGCEENLDDCVAAT
CAPGSTCIDRVGSFSCLCPPGRTGLLCHMEDMCLSQPCHEEAQCSTNPLSGSTLCVCQPG
YTGPTCHQDLDECQMAQQGPSPCEHGGSCLNTPGSFECLCPPGYTGSRCEADHNECLSQP
CHRGGTCLDLLATFQCLCPPGLEGQLCEVEIDECASAPCLNQADCHDLLNGFQCICQPGF
TGPRCEEDINECQSSPCANGGECQDQPGSFHCKCPPGFEGPRCQEEVDECLSGPCPTGAS
CLDLPGAFLCVCPSGFTGHLCEIPLCAPNLCQPKQKCQDQEDNAHCLCPDGNPGCVPTED
NCTCHHGHCQRTRSSCVCDGGWTGPECDTDLGGCVSTPCAHGGTCHPQPFGYNCTCPTGY
TGPTCSEEVTACHSGPCLNGGSCSPSPGGYTCTCPLSHTGLRCQTSIDHCASALCLNGGT
CVNKPGTFSCLCTPGFQGPRCEGRTRPSCADSPCRNMATCQDSPQGPRCLCPPGYTGGSC
QTLMDLCAQKPCPQNSHCLQTGPSFQCLCLQGWTGPLCNLPLSSCQKVALSQGTEVSSLC
QNGGVCIDSGPSHFCHCPPGFQGSICQDQVNPCESRPCQHGATCVAQPNGYLCQCAPGYS
GQNCSEEPDACQSQPCHNQGTCISKPGGFHCACPPGFVGLRCEGDVDECLDRPCHPTGTA
ACHSLANAFYCQCLPGHTGQWCEVELDPCQSQPCAHSGSCEATAGPPPGFTCHCPQGFEG
PTCSHRAPSCGLHHCHHGGLCLPSPKPGLPPRCACLNGYGGPDCLTPPAPSGCGPPSPCL
HNGSCSETPGLGGPGFRCSCPASSPGPRCQRPGVKGCEGRSGDGACDAGCSGPGGNWDGG
DCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACIPAYDQYCRD
HFHNGHCEKGCNTAECGWDGGDCRPEDGNSEWGPSLALLVVLSPSTLDQQLLALARVLSL
TLRVGLWVRKDSEGKDMVYPYPGAQAEEELGGTPDPSQQERAAPQTEPTGKETDSLSTGF
VVVMGVDLSHCGPERPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAAHPRAGTKPS
ANQLPWPVLCSPVVGVLLLALGALLVLQLIRRKRREHGALWLPPGFTRRPRTQPVSRRRR
PPLGEDSIGLKALKAEADMDEDGVVMCSVPKEGEEVGQAEEMASPPKCQLWSLSSDCQEL
PQAAMLTPPQDSEMDVPDVDTQGPDGVTPLMSAVCCGGVESRTYQETWLGSPEPWEPLLE
GGACPQVHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHTAVAADARE
VCQLLLRSRQTAVDARTEDGTTALMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWA
AAVNNARAARSLLQAGADKDAQDGREQTPLFLAAREGAMEVAQLLLGLGAAQGLRDQAGL
TPGDVARQRNHWDLLTLLEGAGPPEARHKPTPGRGAGTFQRARTASGSVPPRGGGAVPRC
RTLSAGARPQARTLSVDLAAHGGGAYSHCRSLSKGTGEGPPLRGRRFSAGMRGPRPNPAM
VRGRPGVSAGSGGVAATVDWPCDWVPLGACGPASNTPIPPPCLTPSPERGSPQVAWGPPA
HQVIPLNAGGEGQK
Download sequence
Identical sequences G3X812
ENSBTAP00000046844 ENSBTAP00000046844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]