SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046960 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000046960
Domain Number 1 Region: 444-539
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-25
Family SPRY domain 0.00078
Further Details:      
 
Domain Number 2 Region: 6-80
Classification Level Classification E-value
Superfamily RING/U-box 1.3e-21
Family RING finger domain, C3HC4 0.0058
Further Details:      
 
Domain Number 3 Region: 313-385
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-19
Family SPRY domain 0.0029
Further Details:      
 
Domain Number 4 Region: 96-157
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000168
Family B-box zinc-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046960   Gene: ENSBTAG00000035744   Transcript: ENSBTAT00000050226
Sequence length 546
Comment pep:known_by_projection chromosome:UMD3.1:23:28563086:28579480:1 gene:ENSBTAG00000035744 transcript:ENSBTAT00000050226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTTDIRSISGGRPVCPLCKKPF
KKENIRPVWQLASLVENIERLKVDRGRQPGEVAQEQADVRLCERHREKLHYYCEDDGKLL
CVMCRESREHRPHSAVLVEKAAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALKK
LQDQRQCIVAEFEQGHQFLREREQHLLGQLAKLEQELTEGREKFKTRGVGELARLAQVIS
ELEGKAQQPAAELMQGTVSLQKDTRDFLNRYPRKKFWIGKPIARVVKKKTGEFSDKLQSL
QRGLREFQGKLLRDLEYKTVSVTLDPQSASGYLQLSEDWKCVTYSGLYQGAYLYPQQFDC
EPGVLGSKGFTWGKVYWEVEVEREGWSEDEDEGDEAEEGEEEEEEEEAGYRDGYDDWETD
EDEESLGDEEEEAEEEEEEVLESCLVGVARDSVKRKGDLSLRPEDGVWALRLSSAGIWAN
TSPEAELFPALRPRRVGIALDYEGGTVTFTNAESQELIYTFTATFTRRLLPFLWLKWPGT
RLLLRP
Download sequence
Identical sequences G3X823
ENSBTAP00000046960 ENSBTAP00000046960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]