SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047271 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047271
Domain Number 1 Region: 79-283
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-55
Family SPRY domain 0.0000151
Further Details:      
 
Domain Number 2 Region: 37-89
Classification Level Classification E-value
Superfamily F-box domain 0.000000000185
Family F-box domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047271   Gene: ENSBTAG00000006388   Transcript: ENSBTAT00000050590
Sequence length 286
Comment pep:known chromosome:UMD3.1:1:71710368:71721053:1 gene:ENSBTAG00000006388 transcript:ENSBTAT00000050590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAGEAMAAPAPGAGAASGGAGCSGGGAGAGSGSGAGGRLPSRVQGLVFSYLELSELRSCA
LVCKHWYRCLHGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKIRAFQHAFSTNDCS
RNVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPLGTVAVIGIATKRAPM
QCQGYVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQIGERIRVILDMEDKT
LAFERGYEFLGVAFRGLPKVCLYPAVSAVYGNTEVTLVYLGKPLDG
Download sequence
Identical sequences G5E639
ENSBTAP00000047271 ENSBTAP00000047271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]