SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047682 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047682
Domain Number 1 Region: 1193-1523
Classification Level Classification E-value
Superfamily NHL repeat 6.8e-24
Family NHL repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 1365-1733
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0000000000902
Family DPP6 N-terminal domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 631-658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000437
Family EGF-type module 0.081
Further Details:      
 
Domain Number 4 Region: 889-960
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000824
Family Carboxypeptidase regulatory domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000047682
Domain Number - Region: 600-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000503
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 697-722
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00101
Family EGF-type module 0.057
Further Details:      
 
Domain Number - Region: 729-754
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00149
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 565-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00168
Family Integrin beta EGF-like domains 0.073
Further Details:      
 
Domain Number - Region: 762-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00193
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 535-559
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0385
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 665-692
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0796
Family Integrin beta EGF-like domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047682   Gene: ENSBTAG00000018819   Transcript: ENSBTAT00000057265
Sequence length 2725
Comment pep:known_by_projection chromosome:UMD3.1:X:8278048:8926654:-1 gene:ENSBTAG00000018819 transcript:ENSBTAT00000057265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQTDCKPYQPLSKVKHEMDLAYTSSSDESEDGRKPRQSYNSRETLHEYNQELRMNYNSQ
SRTRKEVEKSTQEMEFCETPHTLCSGYQTDMHSVSRHGYQLEMGSDVDTETEGAASPDHA
LRMWIRGMKSEHSSCLSSRANSALSLTDTDHERKSDGENGFKFSPVCCDMEAQAGSTQDM
QSSPHNQFTFRPLPPPPPPPHACTCARKPPPAADSLQRRSMTTRSQPSPAAPAPPTSTQD
SVHLHNSWVLNSNIPLETRHFLFKHGSGSSAIFSAASQNYPLTSNTVYSPPPRPLPRSTF
SRPAFTFSKPYRCCNWKCTALSATAITVTLALLLAYVIAVHLFGLTWQLQPAEGQLYENG
VSKGNRGTESMDTTYSPIGGKVSDKSEKKVFQKGRAIDTGEVDIGAQVMQTIPPGLFWRF
QITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLVKQDSRSSDDTQ
HSPRNLILTSLQETGFIEYMDQGPWYLAFYNDGKKMEQVFVLTTAIEIMDDCSTNCNGNG
ECISGHCHCFPGFLGPDCARDSCPVLCGGNGEYEKGHCVCRNGWKGPECDVPEEQCIDPT
CFGHGTCIMGVCICVPGYKGEICEEEDCLDPMCSGHGICVKGECHCSTGWGGVNCETPLP
ICQEQCSGHGTFLLETGTCSCDPKWTGADCSTELCTMECGSHGVCARGICQCEEGWVGPT
CEERSCHSHCAEHGQCKDGKCECSPGWEGDHCTIAHYLDAVRDGCPGLCFGNGRCTLDQN
GWHCVCQVGWSGTGCNVVMEMLCGDNLDNDGDGLTDCVDPDCCQQSNCYVSPLCQGSPDP
LDLIQQSQSLLSQHTLRLFYDRIKFLIGKDSTHVIPPEISFDSRRACVIRGQVVAVDGTP
LVGVNVSFLHHSDYGFTISRQDGSFDLVAIGGISVVLIFDRSPFLPEKRTLWLPWNQFIV
VEKVTMQRVMSDPPSCDISNFISPNPIVLPSPLTSFGGSCPERGTIVPELQVVQEEILIP
SSFVRLSYLSSRTPGYKTLLRILLTHSTIPVGMIKVHLTVAVEGRLTQKWFPAAVNLVYT
FAWNKTDIYGQKVWGLAEALVSVGYEYEMCPDFILWEKRTVILQGFEMDASNLGGWSLNK
HHILNPQSGIIHKGNGENMFISQQPPVIATIMGNGHQRSVACTNCNGPAHNNKLFAPVAL
ASGPDGSVYVGDFNFVRRIFPSGNSVSILELSTSPAHKYYLAMDPMSESLYLSDTNTRKV
YKLKSLVETKDLSKNFEVVAGTGDQCLPFDQSHCGDGGRASEASLNSPRGITVDRHGFIY
FVDGTMIRRIDENAVITTVIGSNGLTSTQPLSCDSGMDITQVRLEWPTDLAVNPMDNSLY
VLDNNIVLQISENRRVRIIAGRPIHCQVPGIDHFLVSKVAIHSTLESARAISVSHSGLLF
IAETDERKVNRIQQVTTNGEISIIAGAPTDCDCKIDPNCDCFSGDGGYAKDAKMKAPSSL
AVSPDGTLYVADLGNVRIRTISRNQAHLNDMNLYEIASPADQELYQFTVNGTHLHTLNLI
TRDYVYNFTYNAEGDLGAITSSNGNSVHIRRDASGMPLWLVVPGGQVYWLTISSNGVLKR
VSAQGYNLALMTYPGNTGLLATKSNENGWTTVYEYDPEGHLTNATFPTGDVSSFHSDLEK
LTKVELDTSNRENVLMSTNLTATSTIYILKQENTQSTYRVSPDGSLRVTFASGMEISLSS
EPHILAGAVNPTLGKCNISLPGEHNANLIEWRQRKEQNKGNISAFERRLRAHNRNLLSID
FDHMTRTGKIYDDHRKFTLRILYDQTGRPVLWSPVSRYNEVNITYSPSGLVTFIQRGTWN
EKMEYDQSGKIISRTWADGKIWSYTYLEKSVMLLLHSQRRYIFEYDQSDCLLSVTMPSMV
RHSLQTMLSVGYYRNIYTPPDSSTSFIQDYSRDGRLLQTLHLGTGRRVLYKYTKQARLSE
ILYDTTQVTLTYEESSGVIKTIHLMHDGFICTIRYRQTGPLIGRQIFRFSEEGLVNARFD
YSYNNFRVTSMQAVINETPLPIDLYRYVDVSGRTEQFGKFSVINYDLNQVITTTVMKHTK
IFSANGQVIEVQYEILKAIAYWMTIQYDNMGRMVICDIRVGVDANITRYFYEYDADGQLQ
TVSVNDKTQWRYSYDLNGNINLLSHGNSARLTPLRYDLRDRITRLGEIQYKMDEDGFLRQ
RGNDVFEYNSNGLLQKAYNKASGWTVQYYYDGLGRRVASKSSPGQHLQFFYADLANPIRV
THLYNHTSSEITSLYYDLQGHLIAMELSSGEEYYVACDNTGTPLAVFSSRGQVIKEILYT
PYGDIYHDTYPDFQVIIGFHGGLYDFLTKLVHLGQRDYDVIAGRWTTPNHHIWKQLNLLP
KPFNLYSFENNYPVGKIQDVAKYTTDIGSWLELFGFQLHNVLPGFPKPELENLELTYELL
QLQTKTQEWDPGKTILGIQCELQKQLRNFISLDQLPMTPRYGDGRCLEGGKQPRFAAVPS
VFGKGIKFAIKDGIVTADIIGVANEDSRRLAAILNNAHYLENLHFTIEGRDTHYFIKLGS
LEEDLVLIGNTGGRRILENGVNVTVSQMTSVLNGRTRRFADIQLQHGALCFNIRYGTTVE
EEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLS
VEQYLELSDSANNIHFMRQSEIGRR
Download sequence
Identical sequences G5E661
ENSBTAP00000047682 ENSBTAP00000047682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]