SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047692 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047692
Domain Number 1 Region: 22-140
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-30
Family Spermadhesin, CUB domain 0.0001
Further Details:      
 
Domain Number 2 Region: 191-303
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-27
Family Spermadhesin, CUB domain 0.0000332
Further Details:      
 
Domain Number 3 Region: 140-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000271
Family EGF-type module 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047692   Gene: ENSBTAG00000037743   Transcript: ENSBTAT00000055395
Sequence length 371
Comment pep:known_by_projection chromosome:UMD3.1:5:103664843:103687826:1 gene:ENSBTAG00000037743 transcript:ENSBTAT00000055395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WLLHLLLPVLFYRVGGAIPTPQGFYGEVMSPLFPKPYPNNFERTTVITVPMGYRVKLVFW
QFDLEPSQGCFYDYVKISADKKTMGRFCGQLGSPLGNPPGRKEFMSQGNKMLLTFHSDFS
NEENGTIMFYKGFLAYYQAVDLDECALQLNSVEEDPPARCQHLCHNYVGSYFCSCRPGYE
LQPDGRSCQAECSSELFTEPSGYISSLEYPRPYPADLRCNYSIRVERGHTLHLQFLEPFE
IDDHQQIHCPYDQLQIYVSGRNIGEFCGKQRPERIDTQSNSVDLLFFTDESGDSRGWKLC
YTSEVITCPQPKTLDSCTIIQDLQPLYHFKDRFTATCKEGYQLIRGTRHSCPSQLSARMM
AHGTVPCPGAG
Download sequence
Identical sequences F1N0N3
ENSBTAP00000047692 ENSBTAP00000047692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]