SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047769 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047769
Domain Number 1 Region: 205-288
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 6.02e-26
Family Thyroglobulin type-1 domain 0.00022
Further Details:      
 
Domain Number 2 Region: 37-120
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.22e-22
Family Growth factor receptor domain 0.0000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047769   Gene: ENSBTAG00000003994   Transcript: ENSBTAT00000053426
Sequence length 291
Comment pep:known chromosome:UMD3.1:4:76705105:76712709:1 gene:ENSBTAG00000003994 transcript:ENSBTAT00000053426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRARPALWAAALTALTLLRGPPAARAGAGTMGAGPVVRCEPCDARAVAQCAPPPPSPPC
AELVREPGCGCCLTCALREGQPCGVYTERCGSGLRCQPPPGDPRPLQALLDGRGLCANAS
AVGRLRPYLLPSASGNGSESEEDHSMGSTENQAGPSTHRVPVSKFHPIHTKMDVIKKGHA
KDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNMLSPRGIHIPNC
DKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGFDVKGKGDVHCYSMESK
Download sequence
Identical sequences I6XXP7 P20959
ENSBTAP00000047769 ENSBTAP00000047769 NP_776981.1.59421 NP_776981.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]