SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047808 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047808
Domain Number 1 Region: 316-352
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000982
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 215-306
Classification Level Classification E-value
Superfamily PKD domain 0.000000017
Family PKD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047808   Gene: ENSBTAG00000032007   Transcript: ENSBTAT00000052954
Sequence length 505
Comment pep:known chromosome:UMD3.1:9:88115145:88183314:-1 gene:ENSBTAG00000032007 transcript:ENSBTAT00000052954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAARESAGLGRRRPPPRRALPGLLLLCLWLPGGRAAGSPSAPLSELHAQLSGVEQLLE
EFRRQLQQERPQEELELELRAGGDPQEGCPGPGGGGYRARPDAIIRTKDSIAAGASFLSA
PAAVQDWRQCLQACCLEPHCSVAVVELPRRPAPPATALGCYLFNCTWRGRSVCKFALHRG
YSSYSLSRSPEGEQEGLEAGAPALTRASPRLEKDEPPLSKAGQDVVLHLPTDGVILDGRE
STDDHAIVQYEWTLLQGDPTVDMKVPQSGTLKLSHLREGAYTFQLTVMDTAGQRSSDNVS
VTVLPVAFSTTGCSSVCSRYHFFCDDGCCIDIMLACDGVEQCPDGSDEAFCQNLSDNRKM
VTHRTTARPKTTGPSTDAGRSASLEKSEKATTPEQPPELSTTEKSNHSTFWGPESRIDLE
MPDGGSSGKNRKEENYIFESKSNRGGGEHPAPEAGAVLPLALGLAITALLLLMVACRLRL
VKQKLKKARPITSEESDYLINGMYL
Download sequence
Identical sequences E1BFN8
ENSBTAP00000047808 ENSBTAP00000047808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]