SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047997 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000047997
Domain Number 1 Region: 43-196
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-19
Family MAM domain 0.01
Further Details:      
 
Domain Number 2 Region: 236-336
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000886
Family MAM domain 0.036
Further Details:      
 
Domain Number 3 Region: 5-38
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047997   Gene: ENSBTAG00000037969   Transcript: ENSBTAT00000057347
Sequence length 350
Comment pep:known chromosome:UMD3.1:13:20930714:20975352:1 gene:ENSBTAG00000037969 transcript:ENSBTAT00000057347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQQGTGAFQCDNGVSLPIDNVCDFTDQCGDMSDEQQCSDYERCDFEDGLCSMIRDQSLR
LGWTKRNGLIGQSPPFYDHNGDMSAHFLSLVSDLDSTSSNISSRVFLPTNNQHACQITFY
CFSSQMNGKLMVGFQTTCGGPIQHLWQNTPGLQNRWERNVIKIQSPQRFQVIFQGQMISA
QDEVIAIDDLSFSSGCLPADDDILPCQEASNTEKELCHPDRSLCRFDSTDEGLRLCQACG
FAFDMCDWVSEATAGQTSWMRTKAREIPVLENAPQQHQSSDDEGYCLWIGAKQASTLNHL
DSRAYLNSSVCHCLGRSCHLQFYYAMENSVLRVGLSNDKVRRNLYYFQIH
Download sequence
Identical sequences A5PJC2
9913.ENSBTAP00000047997 ENSBTAP00000047997 ENSBTAP00000047997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]