SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048125 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048125
Domain Number 1 Region: 5-159
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.77e-42
Family Dual specificity phosphatase-like 0.000000305
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048125   Gene: ENSBTAG00000039121   Transcript: ENSBTAT00000054758
Sequence length 167
Comment pep:known chromosome:UMD3.1:2:122350144:122359897:1 gene:ENSBTAG00000039121 transcript:ENSBTAT00000054758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGI
HVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECG
MKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ
Download sequence
Identical sequences A0A0D9S7Y2 A0A0P6CBS2 A0A1A6HAP5 A0A1U7QI99 A0A1U7UGF7 A0A212D3L5 A0A287AQW6 A0A2I2ZXM0 A0A2I3FQQ1 A0A2I3N7D6 A0A2K5DZI3 A0A2K5K3H3 A0A2K5LEX2 A0A2K5S4A6 A0A2K5ZLY0 A0A2K6BMG2 A0A2K6EWZ6 A0A2K6N560 A0A2K6P7K9 A0A2K6U8I5 A6QL75 A8RMK9 A8RML5 F7EJC3 H2N864 H9EN41 I7GK40 K7D002 K9IWK0 K9K410 L9JDE7 O70274 Q12974 Q6P9X4 S7NDD3 S9YTJ4
ENSSSCP00000003909 ENSNLEP00000002566 ENSPVAP00000012533 ENSCJAP00000012109 ENSBTAP00000048125 NYSGXRC-8690a NYSGXRC-8690b ENSNLEP00000002566 NP_001098468.1.59421 NP_001098468.1.76553 NP_001158217.1.92730 NP_001231270.1.46622 NP_001272163.1.63531 NP_033000.1.92730 NP_536316.1.87134 NP_536316.1.92137 XP_001503912.1.31192 XP_002811180.1.23681 XP_003276404.1.23891 XP_003800789.1.62490 XP_003828183.1.60992 XP_003937626.1.74449 XP_004005084.1.66739 XP_004266585.1.21590 XP_004372069.1.4749 XP_004425932.1.5094 XP_004471383.1.11602 XP_004603610.1.94378 XP_004678787.1.23501 XP_005079554.1.91757 XP_005203059.1.76553 XP_005353230.1.66349 XP_005395094.1.28644 XP_005878396.1.60319 XP_005959577.1.78601 XP_006158184.1.99106 XP_006176251.1.101512 XP_006196975.1.17985 XP_006777457.1.95426 XP_006895013.1.29581 XP_006924368.1.64745 XP_006994424.1.50099 XP_006994425.1.50099 XP_007113438.1.24612 XP_007170652.1.59432 XP_007468718.1.90284 XP_007623133.1.28591 XP_007623134.1.28591 XP_007948652.1.48129 XP_007977804.1.81039 XP_008064951.1.4292 XP_008155245.1.99482 XP_008520115.1.77740 XP_008520116.1.77740 XP_008589331.1.73410 XP_008846337.1.79516 XP_008951737.1.60992 XP_008999052.1.60252 XP_010352161.1.97406 XP_010619877.1.5607 XP_010950484.1.22495 XP_010974393.1.51371 XP_011356128.1.92234 XP_011356129.1.92234 XP_011761504.1.29376 XP_011761505.1.29376 XP_011761506.1.29376 XP_011761508.1.29376 XP_011761509.1.29376 XP_011810835.1.43180 XP_011829418.1.47321 XP_011829419.1.47321 XP_011935106.1.92194 XP_011935107.1.92194 XP_011981868.1.54773 XP_012295417.1.9421 XP_012366902.1.23891 XP_012497785.1.63892 XP_012620891.1.48125 XP_012975708.1.91757 XP_014639583.1.5094 XP_014639584.1.5094 XP_014693424.1.49734 XP_014693425.1.49734 XP_014693426.1.49734 XP_014961499.1.54773 XP_014988659.1.72884 XP_014988664.1.72884 XP_014988669.1.72884 XP_014988680.1.72884 XP_014988688.1.72884 XP_015096253.1.17985 XP_015306929.1.63531 XP_015306938.1.63531 XP_015306948.1.63531 XP_016005900.1.101085 XP_016005901.1.101085 XP_016005902.1.101085 XP_016073011.1.3490 XP_016813579.1.37143 XP_016813582.1.37143 XP_016813586.1.37143 XP_017175534.1.92730 XP_017383398.1.71028 XP_017383399.1.71028 XP_017449153.1.100692 XP_017449154.1.100692 XP_017532222.1.32401 XP_017712550.1.44346 XP_017913073.1.57651 XP_018869876.1.27298 XP_018869878.1.27298 XP_018869879.1.27298 XP_019515335.1.44202 XP_019515344.1.44202 XP_019515353.1.44202 XP_019585537.1.88060 XP_019585538.1.88060 XP_019834897.1.53367 XP_020738417.1.74333 XP_020949048.1.46622 XP_020949049.1.46622 XP_511509.4.37143 ENSMUSP00000030578 ENSPPYP00000001851 ENSTSYP00000007786 ENSBTAP00000048125 gi|18104971|ref|NP_536316.1| ENSDNOP00000022736 ENSP00000344909 ENSP00000473259 10090.ENSMUSP00000030578 9600.ENSPPYP00000001851 9606.ENSP00000344909 ENSTTRP00000015709 ENSPVAP00000012533 ENSMUSP00000030578 ENSMUSP00000125901 ENSSSCP00000003909 ENSPPYP00000001851 ENSMUSP00000030578 ENSRNOP00000064832 ENSP00000344909 ENSP00000473259 ENSP00000344909 ENSTTRP00000015709 ENSCJAP00000012118 ENSTSYP00000007786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]