SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048145 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048145
Domain Number 1 Region: 25-110
Classification Level Classification E-value
Superfamily Immunoglobulin 2.19e-21
Family V set domains (antibody variable domain-like) 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048145   Gene: ENSBTAG00000038934   Transcript: ENSBTAT00000053230
Sequence length 111
Comment pep:novel chromosome:UMD3.1:4:106521518:106521937:1 gene:ENSBTAG00000038934 transcript:ENSBTAT00000053230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPCLLGCVVFCLLQAGAVHAGVSKDPIFHVVRRGQSATLTCTQDLNFSYMYWYRQDPGN
GLRLIHYSVIPPSMEKGPVPEGYRFSRPSTENFPLTLESANCSLTSVYFCT
Download sequence
Identical sequences E1BJ95
ENSBTAP00000048145 ENSBTAP00000048145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]