SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048230 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048230
Domain Number 1 Region: 12-119
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000762
Further Details:      
 
Domain Number 2 Region: 235-344
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 118-225
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048230   Gene: ENSBTAG00000034678   Transcript: ENSBTAT00000056039
Sequence length 415
Comment pep:novel chromosome:UMD3.1:5:103110444:103113609:-1 gene:ENSBTAG00000034678 transcript:ENSBTAT00000056039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSPPHCPISLFSERRQLRLVDGGGLCAGRVEILDQGSWGTICDDGWDLDDARVVCRQLSC
GEALNATRSAHFGEGPGPIWLDDLNCTGNESHVWRCPSRGWGRHDCRHKEDAGVICSEFL
ALRMVSEDQECAGWLEVFYNGTWGSVCRSPMDDVTVSIICSQLGCGDSGSLNTSVGLREG
SRPHWVDGIQCQRTDPSLWQCPSDPWNYNSCFPKEEAYISCAGRRPKSCPTAAPCTDREK
LRLRGGDTECSGRVEVWHSGSWGTVCDDSWSLEEAKVVCQQLGCGQALEALQAATFGPGN
GSIWLDEVQCRGQESSLWDCAAEPWGQSDCKHKEDAGVRCSGARTSLPPTTAGTVIHLQS
DSGACSVGSLTAQERKESEEPLAVEEEPGSYVWELPYPGFRGQKVLMPRVQVGLV
Download sequence
Identical sequences F1MBZ9
ENSBTAP00000048230 ENSBTAP00000048230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]