SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048250 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048250
Domain Number 1 Region: 5-116
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.72e-19
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 2 Region: 90-188
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000554
Family Laminin G-like module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048250   Gene: ENSBTAG00000000719   Transcript: ENSBTAT00000056755
Sequence length 197
Comment pep:novel chromosome:UMD3.1:4:111220051:111231644:1 gene:ENSBTAG00000000719 transcript:ENSBTAT00000056755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNQLGPIYGHTSVMTGSLLDDHHWHSVVIERQGRSINLTLDRSTQHFRTNGEFDYLDLDY
EITFGGIPFSGKPSSSSRKNFKGCMESINYNGINITDLARRKKLEPSNVGNLSFSCVEPY
TVPVFFNATSYLEVPGRLHQDLFSVSFQFRTWNPNGLLLFSHFADNLGNVEIDLTESKVG
VHINVTQTKMNQIDISS
Download sequence
Identical sequences F1MBW9
ENSBTAP00000048250 ENSBTAP00000048250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]