SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048275 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048275
Domain Number 1 Region: 217-326
Classification Level Classification E-value
Superfamily SRCR-like 8.76e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000709
Further Details:      
 
Domain Number 2 Region: 431-535
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 324-429
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 
Domain Number 4 Region: 85-191
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.006
Further Details:      
 
Domain Number 5 Region: 2-83
Classification Level Classification E-value
Superfamily SRCR-like 9.42e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048275   Gene: ENSBTAG00000039041   Transcript: ENSBTAT00000056482
Sequence length 723
Comment pep:known chromosome:UMD3.1:5:102715224:102729724:1 gene:ENSBTAG00000039041 transcript:ENSBTAT00000056482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DWTPVSDGNFTLPTAQVICAELGCGKAVSVLGHVPFRESDGQVWAEEFRCKGEEPKLWSC
PRVPCPGGACHHSGVAQVVCSVYAEVRLMTNGTSQCEGQVEMNISGRWRALCASHWTLAN
ANVVCHQLGCGVAISTPRGPRFVEGGDQISTVRFHCSGAESVLWMCPVTALGGFDCSLGN
TAYVICSGNQTQALPQCNDSLSEPAGSAASEESALYCSDSRLLRLVDGGGHCAGRVEILD
QGSWGTICDDGWDLDDAHVVCRQLGCGEALNATSSAHFGAGSGPIWLDDLNCTGNESHLW
RCPSRGWGQHDCRHKEDAGVICSEFVAFRMVSEDQQCAGWLEVFYNGTWGSVCRSPMEDI
TVSIICRQLGCGDSGSLNSSVALREGSRPHWVDGIQCRKTDTSLWHCPSDFWNYNSCSPK
EEAYISCADREKLRLRGGDTECSGRVEVWHSGSWGTVCDDSWSLAEAEVVCQQLGCGQAL
EAMQAATFGPGNGSIWLDEVRCRGQESSLWDCALEPWGQSDCKHEEDAGVRCSGELRRGK
WAALHSDQSPCSNLFLFSLGARTTLPPSTAGTVVHPRAELHVLCDELLWLSILRFLGHLQ
TQCVPHTHRGSSYKVVGWPLRALKAPRLHCRSQVCPFPALIQVLCVWGGSFCVLCDGREE
EELPEKEDGIRPFQTGSFLNVSREEANPGEGEESPWLLQGEKGDPGYDDVELSVPGTSSV
TFS
Download sequence
Identical sequences F1MBC6
ENSBTAP00000048275 ENSBTAP00000048275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]