SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048314 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048314
Domain Number 1 Region: 166-441
Classification Level Classification E-value
Superfamily L domain-like 1.02e-41
Family Ngr ectodomain-like 0.025
Further Details:      
 
Domain Number 2 Region: 20-226
Classification Level Classification E-value
Superfamily L domain-like 3.74e-32
Family Ngr ectodomain-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048314   Gene: ENSBTAG00000039574   Transcript: ENSBTAT00000055571
Sequence length 512
Comment pep:known chromosome:UMD3.1:9:33595874:33619430:-1 gene:ENSBTAG00000039574 transcript:ENSBTAT00000055571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLLYAFLALLSLCYGLDPHCPGRCSCDSEQSVQCYRLTEVPSGIPSTTKKLYISHSKIQ
HLQLSNFTQMLALEDFLLLASGTESVENDTFKTLSTLKTLELWKNKLRRVPRALPASLEV
LKLNDNSIYVLHGSDFEGLKKLKILELKNNLISSISTSMLSSLVSLQSLMLDANNIENVE
GPLALPHLKHLSMENNKLHLIPASFFTSLQSLQFLSFSSNFLTKIPINLPKSLLSLKMER
NRLKAVRFRDMKHLENLSHLYLSENSLSSIEGAQLLANLTTLEVSQNQLQTLPLRLPARL
QKLDISNNLIRKVTAQDFRDLRDLKHLFLDNNIVSLFEAGALQKCSQLSNLALEQNLLLS
IPLRLPGTLARLDLKGNAIQDIAEREVKDLKQLQVLNLRNNRLSALDLKALEVLPRLRHL
YLDGNPWNCTCSLLRAREVLKAKGTDVRGGQCVAPAERQGESWMSSKKIMKQCEHHLHLT
EKSKETKKKPKLEEHASIRINVDDDYYDYEID
Download sequence
Identical sequences A6QPQ1
ENSBTAP00000048314 ENSBTAP00000048314 NP_001096797.1.59421 NP_001096797.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]