SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048338 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000048338
Domain Number - Region: 247-337
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.00942
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048338   Gene: ENSBTAG00000014273   Transcript: ENSBTAT00000052122
Sequence length 448
Comment pep:known chromosome:UMD3.1:4:94264903:94359377:1 gene:ENSBTAG00000014273 transcript:ENSBTAT00000052122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEHGVTQTEHMATIEAHAVAQQVQQVHVATYTEHSMLSADEDSPSSPEDTSYDDSDILN
STAADEVTAHLAAAGPVGMAAAAAVATGKKRKRPHVFESNPSIRKRQQTRLLRKLRATLD
EYTTRVGQQAIVLCISPSKPNPVFKVFGAAPLENVVRKYKSMILEDLESALAEHAPAPQE
VNSELPPLTIDGIPVSVDKMTQAQLRAFIPEMLKYSTGRGKPGWGKESCKPIWWPEDIPW
ANVRSDVRTEEQKQRVSWTQALRTIVKNCYKQHGREDLLYAFEDQQTQTQATTTHSIAHL
VPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSAVADGEVEQNW
ATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVTMALNRWRQGWAIKEEGD
SVPVYRCKEKRRTSLCHNWHLKLNTLNP
Download sequence
Identical sequences A5D7S2
ENSBTAP00000048338 ENSBTAP00000048338 NP_001091471.1.59421 NP_001091471.1.76553 XP_005905334.1.15283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]