SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048368 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048368
Domain Number 1 Region: 160-342
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-26
Family SPRY domain 0.017
Further Details:      
 
Domain Number 2 Region: 370-540
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000107
Family Nucleotide and nucleoside kinases 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048368   Gene: ENSBTAG00000007606   Transcript: ENSBTAT00000052059
Sequence length 701
Comment pep:known chromosome:UMD3.1:16:33163184:33172676:1 gene:ENSBTAG00000007606 transcript:ENSBTAT00000052059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAASEDENGDDQGFQEGEDELGEEEEGAGDENGHGEQQPQPPAAPQQQPQQQRGAAKEAA
GKSSGPTSLFAVTVAPPGARQGQQQAGGKKKAEGGGGGGRPGAPAAGDGKTEQKGGDKKR
GVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFKISRD
RLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVRIGWS
LTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFESDEVELSYAKN
GQDLGIAFKISKEVLAGRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEDYTFIQNVPLEDR
VRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKK
QMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAV
VVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQK
LLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGAP
GNRGGYNRRGSMPQRGGGGGGSGGIGYPYPRGPVFPSRGGYSNRGNYNRGGMPNRGNYNQ
NFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY
Download sequence
Identical sequences F1MFT4
ENSBTAP00000048368 ENSBTAP00000048368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]