SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048641 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048641
Domain Number 1 Region: 71-284
Classification Level Classification E-value
Superfamily L domain-like 3.4e-48
Family Internalin LRR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048641   Gene: ENSBTAG00000015786   Transcript: ENSBTAT00000053822
Sequence length 334
Comment pep:known chromosome:UMD3.1:3:43251251:43272503:1 gene:ENSBTAG00000015786 transcript:ENSBTAT00000053822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSENVVSTGAVNAVKEVWEKRIKKLNEDLKREKEFQQKLVRIWEERVCLTKLREKVTKED
GRVILKIEKEEWKTLPSSLLKLNQLQEWQLHRIGLLKIPEFIGRFQNLIVLDLSRNTITE
IPRGIGLLTRLQELILSYNRIKTVPMELSYCASLEKLELAVNRDISDLPQELSNLLKLTH
LDLSMNLFTTIPPAVLNMPALEWLDMGSNRLEQLPDTIERMQNLHTLWLQRNEITCLPET
ISSMKNLSTLVLSNNKLQDIPVCMEKMTNLRFVNFRDNPLKLEVTLPPSENIEEEEEREL
FGLQFMHTYIQESRRAGNQVNCSTTSPNSIDADG
Download sequence
Identical sequences Q3ZC49
ENSBTAP00000048641 NP_001069893.1.59421 NP_001069893.1.76553 XP_010829294.1.44457 ENSBTAP00000048641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]