SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048722 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048722
Domain Number 1 Region: 124-507
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.21e-145
Family Myotubularin-like phosphatases 0.0000000307
Further Details:      
 
Domain Number 2 Region: 8-114
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-16
Family GRAM domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048722   Gene: ENSBTAG00000010372   Transcript: ENSBTAT00000055365
Sequence length 660
Comment pep:known chromosome:UMD3.1:27:18914043:19014503:1 gene:ENSBTAG00000010372 transcript:ENSBTAT00000055365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHIRTPKVENVRLVDRISSKKAALGTLYLTATHVIFVETAPDTRKETWILHSQIATIEK
QATTATGCPLLIRCKNFQLLQLIIPQERDCHDVYISLIRLARPVKYEELYCFSFNPKLDR
EEREQGWMLIELSEEYKRMGLPNEYWQLSDVNREYRICDSYPTELYVPKSATAHIIVGSS
KFRSRRRFPALSYYYKDNHASICRSSQPLSGFSARCLEDEQMLQAIRKANPGSDFLYVVD
TRPKLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRNSLQKMLEVCELKSPSMSDF
LWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHCSDGWDRTAQVCSVASLLLEPHY
RTLKGFMVLIEKDWISFGHKFTHRYGNLDGDPREISPVIDQFLECVWQLMEQFPCAFEFN
ERFLIHIQHHIYSCQFGNFLCNSQKERQELKIQERTYSLWAHLWKNRADYLNPLFRADHS
QTRGVLHLPTAPCNFMYKFWNGMYNRFEKGLQPRQSVTDYLMAVKEETQQLEEELEALEE
RLEKIQKVQLNRTKVRSKQSEPSKHSGFSTSDNSAANTPQDYSGNVKSFPSRSPSQGDED
SALILTQDNLKSSDPDLSANSDQESGVEDLSCRSPSGGECVPSEDSGKDRDSDEAVFLTA
Download sequence
Identical sequences E1BEV2
ENSBTAP00000048722 ENSBTAP00000048722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]