SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048757 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048757
Domain Number 1 Region: 5-81
Classification Level Classification E-value
Superfamily RING/U-box 7.3e-17
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 2 Region: 444-538
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-16
Family SPRY domain 0.0017
Further Details:      
 
Domain Number 3 Region: 95-158
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000118
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 4 Region: 310-382
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000034
Family SPRY domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048757   Gene: ENSBTAG00000037421   Transcript: ENSBTAT00000057407
Sequence length 545
Comment pep:novel chromosome:UMD3.1:23:28530978:28540122:-1 gene:ENSBTAG00000037421 transcript:ENSBTAT00000057407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATASPLRKLEDKVMCSICPDYLKDPLTIDCSHIFCYHCIIKVCESAQQPLYYSLCKTAF
KKENIRHVWQMASIVKNIWRMKVDEERQPREDRPLAQRAEQLCGQHLEKLHYYCKDDQQI
LCVMCQESREHRHHAAVLLEKAAQPYQGKILNHLKILKGDRDRIQNSQSTGEDEIQALLA
KFQSHKQDAASVFEQGHQFLREREQHLLEWLEGTEQQLTEGRNSHVTKGSEEVIRLETLI
SELEKKARQQALELLQVRDQTLSRLSLLYPWKKFWIKAYQSAMRKQTEEFSDKLLCLEKG
LRGFHGKLMRDLEYKTMRIILNSQRANGYLSVSPNGKSMMFTGLWLKKCQHGQQFDLEPG
VLGSKGFMWGKVYWEVKVDRIWWEAEEEEDARRYGAGCRGVFGSNDLGGFISITDGYHSP
GYREENEELEEECSQENGIWPKFCLVGVVRESVVRRGFLNFTPEGIWTPQLSSAGVSICT
SPEPFQILSYCPGQIGVALDHDGGKVTFTNARTQEFIYEFSSTFTGRIFPFLWLNYMRSR
LSLRP
Download sequence
Identical sequences E1BES5
ENSBTAP00000048757 ENSBTAP00000048757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]