SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048816 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048816
Domain Number 1 Region: 244-307
Classification Level Classification E-value
Superfamily RILP dimerisation region 5.89e-18
Family RILP dimerisation region 0.0000403
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048816   Gene: ENSBTAG00000038889   Transcript: ENSBTAT00000056799
Sequence length 407
Comment pep:known_by_projection chromosome:UMD3.1:19:23320981:23323996:-1 gene:ENSBTAG00000038889 transcript:ENSBTAT00000056799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRRAVPGAHGCGPRVAAGSGTAAELVYHLAGALGAELQELARRFGPEAAAGLVPLVVQ
ALELLEKAAVGPTPDSLQVSAQHAELELRRLREENERLRRELRSGPQEERALLRQLKEVT
DRQRDELRAYNRDLLQRSQETEALQEQLQRLLLVNAELRQKLAAVQTQLRAARDRESERE
QRREAAVEPPPEPVQGQAAGPGCEQRRESERAAAGTRAPGTPEDPADAPLPPGLPAKAGQ
CSFSREEVQQILQERNELKANVFLLKEELAYFQRELLTDHRVPGLLLEAMKVAVKKQRKK
IKAKMLGTPEEAESSDDEDGSWLLLSSDKGDHSEPPAPESRIQSFFGQWYRGEAEAPGTE
TSRVAPSQLQGGEETLQPPHQEPPPTPDGSCCALNEHLCLESQLPQR
Download sequence
Identical sequences E1B8X6
ENSBTAP00000048816 ENSBTAP00000048816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]