SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048971 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048971
Domain Number 1 Region: 336-651
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.5e-55
Family Rhodopsin-like 0.00096
Further Details:      
 
Domain Number 2 Region: 21-245
Classification Level Classification E-value
Superfamily L domain-like 7.29e-44
Family Ngr ectodomain-like 0.0000000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048971   Gene: ENSBTAG00000032424   Transcript: ENSBTAT00000056513
Sequence length 695
Comment pep:known_by_projection chromosome:UMD3.1:11:31110744:31305197:-1 gene:ENSBTAG00000032424 transcript:ENSBTAT00000056513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLLVALLAFLSLGSGCHHRLCHCSNGVFLCQESKVTEIPSDLPRDAVELRFVLTKLRV
IPKGAFSGFGDLEKIEISQNDVLEVIEANVFSNLPKLHEIRIEKANNLLYIDADAFQNLP
NLRYLLISNTGIKHLPAVHKIQSLQKVLLDIQDNINIHTVERNSFMGLSFESMTVWLSKN
GIQEIHNCAFNGTQLDELNLSDNSNLEELPNDVFQGASGPVILDISRTRIRSLPSYGLEN
LKKLRAKSTYRLKKLPSLEKFVTLVEASLTYPSHCCAFANWRRQTSDLHPVCNKSILRQE
VDDMTQARGQRVSLAEDDEPSYAKGFDVMYSEFDYDLCNEVVDVTCSPEPDAFNPCEDIM
GDDILRVLIWFISILAITGNILVLVILITSQYKLTVPRFLMCNLAFADLCIGIYLLLIAS
VDVHTKSQYHNYAIDWQTGAGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLECK
VQLRHAASIMLVGWIFAFAVALFPIFGISSYMKVSICLPMDIDSPLSQLYVMSLLVLNVL
AFVVICGCYTHIYLTVRNPNITSSSSDTKIAKRMAMLIFTDFLCMAPISFFAISASLKVP
LITVSKSKILLVLFYPINSCANPFLYAIFTKNFRRDFFILLSKFGCYEVQAQTYRSETSS
TAHNFHPRNGHCPPAPRVTNGSNYTLIPLRHLAKN
Download sequence
Identical sequences F1MT42
ENSBTAP00000048971 ENSBTAP00000048971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]