SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049263 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049263
Domain Number 1 Region: 18-112
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 6.21e-34
Family VPS28 N-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 125-219
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 0.000000000000017
Family VPS28 C-terminal domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049263   Gene: ENSBTAG00000026320   Transcript: ENSBTAT00000054515
Sequence length 221
Comment pep:known_by_projection chromosome:UMD3.1:14:1693641:1698490:1 gene:ENSBTAG00000026320 transcript:ENSBTAT00000054515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGMGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VTPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKD
DKGNLNRCIADVVSVRITNSMDMSLNIKKQNKTKKDVQLFLKTSNYLKTSPTRFSGAQKV
SRVLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA
Download sequence
Identical sequences E1BIB3
ENSBTAP00000049263 ENSBTAP00000049263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]