SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049290 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049290
Domain Number 1 Region: 360-576
Classification Level Classification E-value
Superfamily L domain-like 1.7e-35
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 2 Region: 39-262
Classification Level Classification E-value
Superfamily L domain-like 1.07e-34
Family Ngr ectodomain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049290   Gene: ENSBTAG00000038168   Transcript: ENSBTAT00000054494
Sequence length 696
Comment pep:known_by_projection chromosome:UMD3.1:12:59144543:59146633:-1 gene:ENSBTAG00000038168 transcript:ENSBTAT00000054494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQF
YHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKRLHINNNKIKS
FRKQTFLGLDDLEYLQADFNLLRDIDPGAFQDLNKLEVLILNDNLISTLPANVFQYVPIT
HLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDLLSLKEWLENIPKNALIGRVV
CEAPTRLQGKDLNETTEQDLCPLKHRVDSSLPAPPAQEETFPPGPLPTPFKTNGQEDHAT
PGSAPNGGTKIPGNWQIKIRPTAAIGTGSARNKPPANGLPCPGGCSCDHIPGSGLKMNCN
NRNVSSLADLKPKLSNVQELFLRDNKIHSIRKSHFVDYKNLILLDLGNNNIATVENNTFK
NLLDLRWLYMDSNYLDTLSREKFAGLQNLEYLNVEYNAIQLILPGTFNAMPKLRILILNN
NLLRSLPVDVFAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPF
KQWAERLGSEVLMSDLKCETPVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLA
ETGTHSNSYLDTSRVSISVLVPGLLLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASE
INSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD
Download sequence
Identical sequences F1MJJ9 W5Q6R2
ENSBTAP00000049290 XP_005907346.1.15283 XP_005977847.1.78601 XP_010853004.1.44457 XP_010853005.1.44457 XP_010853006.1.44457 XP_012022259.1.54773 XP_012040227.1.66739 XP_015321221.1.59421 XP_015329358.1.76553 XP_017911946.1.57651 XP_019827436.1.53367 ENSBTAP00000049290 ENSOARP00000018403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]