SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049342 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049342
Domain Number 1 Region: 531-637
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000614
Further Details:      
 
Domain Number 2 Region: 215-322
Classification Level Classification E-value
Superfamily SRCR-like 1.28e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000672
Further Details:      
 
Domain Number 3 Region: 320-425
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000866
Further Details:      
 
Domain Number 4 Region: 760-870
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 5 Region: 111-217
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0044
Further Details:      
 
Domain Number 6 Region: 636-744
Classification Level Classification E-value
Superfamily SRCR-like 6.28e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0014
Further Details:      
 
Domain Number 7 Region: 429-533
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.005
Further Details:      
 
Domain Number 8 Region: 7-109
Classification Level Classification E-value
Superfamily SRCR-like 6.02e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049342   Gene: ENSBTAG00000045768   Transcript: ENSBTAT00000052627
Sequence length 920
Comment pep:novel chromosome:UMD3.1:5:103032491:103060434:-1 gene:ENSBTAG00000045768 transcript:ENSBTAT00000052627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLLGFMRLAEGDGPCSGRVEVHSGKDWTPVSDGNFTFPTAQVICAELRCGKVLSVLGHV
PFRESGGRVWAEEFRCKGEETELWSCPRVPCPGGICHHSGAVQIVCSAMYTEVRLMTNSS
SQCEGQVEMNISGRWRALCASHWSMANANVVCRQLNCGVAISTPRGPHFVEGSDQISTVR
FHCSGMESFLWSCPVTVLGGPDCSHGNTASVICSDSRQLRLVDGGGPCAGRVEILDQGSW
GTICDDGWDLDDARVVCRQLGCGEALNAMGSAHFGVGSGPIWLNNLNCTGNESHVWKCPS
RGWGRHDCRHKQDAGVICSGSRQLRLVDGGGPCTGRVEILDQGSWGTICDDGWDLEDARV
VCRQLGCGEALNALQFAELGQGSGPIWLDELNCGGKESHVWRCPSQGWGRHDCGHKEDAG
VVCSVYAEARLVTNGSSWCEGQVEMNISGRWIALCASHWSLANANVVCRQLGCGVAISTP
RGPRFVEGGDQISTVRFHCSGAESFLWMCPVTALGGLDCSHGNTAYAICSDSRQLRLVEG
GSHCAGRVEIFDQGSWGTICDDGWDLDDAHVVCRQLGCGEALNATGSAHFGAGSGPIWLD
DLNCTGNESHVWRCPSRGWGRHDCRHKEDAGVICSEFLALRMVSEDQQCAGWLEVFYNGT
WGSVCRSPMEDITVSIICRQLGYGDSGSLNSSVALREGSRPHWVDGIQCRKTDTSLWQCP
SDSWNYNSCSPKEEAYISCAGKQLIRYRRRPKSCPTAAPCTDREKLQLRGGDSECSGRVE
VWHSGSWGTVCDDSWSLAEAEVVCQQLGCGPALEAMQGAEFGPGNGSIWLDEVRCGGRES
SLWDCAAEPWGQSDCKHEEDAGVRCSGARTTLAPSTAGTRTTSNPLPGIFSLPGVLCLIL
GSLLFLVLIILVTQLLRWRA
Download sequence
Identical sequences F1MKN8
ENSBTAP00000049342 ENSBTAP00000049342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]