SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049409 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049409
Domain Number 1 Region: 962-1027
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.55e-21
Family TB module/8-cys domain 0.0000105
Further Details:      
 
Domain Number 2 Region: 1135-1196
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.88e-17
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 3 Region: 344-394,490-510
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.96e-16
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 4 Region: 738-870
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000188
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 5 Region: 493-621
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000628
Family Growth factor receptor domain 0.008
Further Details:      
 
Domain Number 6 Region: 224-290
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000366
Family TB module/8-cys domain 0.0037
Further Details:      
 
Domain Number 7 Region: 644-780
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000879
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 863-916
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000453
Family EGF-type module 0.018
Further Details:      
 
Domain Number 9 Region: 291-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000258
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 10 Region: 1082-1127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000014
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 11 Region: 1240-1324
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000267
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 12 Region: 1049-1095
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000308
Family EGF-type module 0.021
Further Details:      
 
Domain Number 13 Region: 77-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000221
Family EGF-type module 0.019
Further Details:      
 
Domain Number 14 Region: 615-651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000176
Family EGF-type module 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049409   Gene: ENSBTAG00000019839   Transcript: ENSBTAT00000055559
Sequence length 1338
Comment pep:known chromosome:UMD3.1:11:15676467:15947670:1 gene:ENSBTAG00000019839 transcript:ENSBTAT00000055559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKLMCLLFFFSLPPLLVSNHTGRIKVVFTPSICKVTCTKGSCQNSCEKGNTTTLISEN
GHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQCPPNFTGKLCQIPVHGASLPKVYQHS
QQSGKALGTHVVHSTHTLPLTMTSQQGVKVKFPPNIVNIHVKHPPEASVQIHQVSRVDGP
TGQKVKEAQPGQSQAPYQGLPVQKTQTVHSSYQQVIPHVYPVAAKTQLGRCFQETIGSQC
GKALPGLSKQEDCCGTVGTSWGFHKCQKCPKKPSYHIYKNKIQCIQGYKERNNVFTSDIN
ECQLQGVCPNGECLNTMGSYRCTCKVGFGPDPTFSSCVPDTPVISEEKGPCYRLVSSGRQ
CMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLPGTAKEEPVEALTFSREQGPGAVEPEVAT
VPPEKEIPSLDQEKTRLEPGQPQLSPGISTIHLHPQFPVVIEKTSPPMPVEVAPEASTSS
ASQVIAPTQVTEINECTVNPDICGAGHCINLPVRYTCICYDGYKFNEQQRKCVDIDECAQ
DQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTMGAFRC
EYCDSGYHMTPGGQCEDVDECLTPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDE
CLEPKICTNGTCSNLEGSYMCSCHKGYSPTPDHKHCEDIDECQQGTMCMNGQCKNTDGSF
RCTCGQGYQLSAAKDQCEDIDECQHHHLCSNGQCRNTEGSFRCVCDHGYRASALGDHCED
INECLEDKSVCQGGDCINTKGSYECTCPDGFQLNDNKGCQDINECEQPGLCGPHGECLNT
DSSFHCICEQGFSISADGRTCEDIDECVNNTICDSHGFCDNTAGSFRCLCYQGFQAPQDG
QGCVDVNECELLSGVCGEAFCENVEGSFLCVCADESQEYSPMTGQCRSRLSMDSEVDEPR
EEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGAGWGDNCEIFPCPVPGTAEFTEMCPR
GKGFVPSEESSYGVDGENYKDADECLLFGQEICKNGFCMNTQPGYECYCKQGTYYDPVKL
QCFDIDECQDPNSCIDGQCINTEGSYNCFCTHPMVLDASEKRCIRPTESHEQIEETDVYQ
DLCWEHLSDEYVCSRPLVGKQTTYTECCCLYGEAWGMQCALCPMKDSDDYAQLCNIPVTG
RRRPYGRDALVDFSEQYAPEADPYFVRDRFLNSFEELQAEECGILNGCENGRCVRVQEGY
TCDCFDGYHLDMAKMTCVDVNECDELNNRMSLCKNAKCINTEGSYKCVCLPGFVPSDKPN
YCTPLNTALNLEKDSDLE
Download sequence
Identical sequences F1MJM5
ENSBTAP00000049409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]