SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049410 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049410
Domain Number 1 Region: 20-283
Classification Level Classification E-value
Superfamily L domain-like 7.29e-49
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 2 Region: 279-372
Classification Level Classification E-value
Superfamily Immunoglobulin 9.18e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 405-480
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000984
Family Fibronectin type III 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049410   Gene: ENSBTAG00000037404   Transcript: ENSBTAT00000053062
Sequence length 636
Comment pep:known_by_projection chromosome:UMD3.1:29:45517059:45519576:1 gene:ENSBTAG00000037404 transcript:ENSBTAT00000053062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPLLLLLLASGAAACPLPCICQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFI
QALGPPDFRNMTGLVDLTLSRNAITRIGARAFGDLESLRSLHLDGNRLAELGAGSLRGPA
NLQHLILSGNQLGRIAPGAFDDFLGSLEDLDLSYNNLRQVPWAGIGAMPALHTLNLDHNL
IDALPPGAFAQLSQLSRLDLTSNRLATLAPDPLFSRGRHAEASPAPLVLSFSGNPLHCNC
ELLWLRRLARPDDLETCASPPGLAGRYFWTVPEGEFSCEPPLIARHTQRLWVLEGQRATL
RCRALGDPVPTMHWVGPDDRLVGNSSRARAFPNGTLEIGVTGSGDAGAYTCIATNPAGEA
TARVELRVLALPHGGNGSTEGGRPGPSDIAASARTAAEGEGTPESEPAVQVTEVTATSGL
VSWGPGRPADPVWMFQLQYNSSEDETLIYRIVPASSHHFLLKHLVPGADYDLCLLALSPA
AGPSDLTATRLLGCAHFSTLPATPLCHALQAHVLGGTLTVAVGGVLVAALLVFTVALLVR
GRGAGNGRLPLKLSHVQSQTNGGPSPTPKAHPPRSPPPRPQRSCSLDLGDSGGCYGYARR
LGGAWARRSHSVHGGLLGAGGRGAGGSAERLEESVV
Download sequence
Identical sequences F1MJL8
NP_001193183.1.59421 NP_001193183.1.76553 XP_005227167.1.76553 ENSBTAP00000049410 ENSBTAP00000049410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]