SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049498 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049498
Domain Number 1 Region: 58-122
Classification Level Classification E-value
Superfamily L domain-like 0.00000000000486
Family Ngr ectodomain-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049498   Gene: ENSBTAG00000039059   Transcript: ENSBTAT00000055945
Sequence length 202
Comment pep:known_by_projection chromosome:UMD3.1:17:74811513:74812320:1 gene:ENSBTAG00000039059 transcript:ENSBTAT00000055945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFGLRGALSLLLLLLAPPGRSAAGCPAPCRCAGTRVDCGRRGLTWASLPAVFPPDTTEL
VLTGNNLTALPPGLLDALPVLRAAHLGANPWRCDCHLVPLRAWLAGRPEREPYRDLRCAA
PPALRGRLLPYLAEDELRATCAPGALCRGALAAQLLLLVLGLLHALLLALLLCRLRSLRA
RATRRRPLSEPLAAERATPEPS
Download sequence
Identical sequences E1B863
ENSBTAP00000049498 ENSBTAP00000049498 9913.ENSBTAP00000049498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]