SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049744 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049744
Domain Number 1 Region: 5-352
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.16e-74
Family ADP-ribosylglycohydrolase 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049744   Gene: ENSBTAG00000009391   Transcript: ENSBTAT00000053553
Sequence length 353
Comment pep:known chromosome:UMD3.1:1:64933574:64937122:1 gene:ENSBTAG00000009391 transcript:ENSBTAT00000053553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGALMERYVAAMVLSAAGDALGYFNGKWEFLQNGEKIHRQLAQLGGLDAIDVERWRVSD
DTVMHLATAEALLEAGKVSDLTHLYSLLAKHYQDCMGDMDGRAPGGASVQNAMLLEPDKA
DGWRIPFNSHEGGCGAAMRAMCIGLRFPHSSQLDSLIQVSIESGRMTHHHPTGYLGALVS
ALFTAYAVNGKPPQQWGRGLMEVLPEAKKYIVQSGFFVEQNLQHWSYFQDQWEKYLKLRG
IWDGKSAPTFPKPFDVKERDQFYSSVSYSGWGGSSGHDAPMIAYDAILAAGDSWKELAHR
AFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLR
Download sequence
Identical sequences Q32KR8
ENSBTAP00000049744 NP_001033643.1.59421 NP_001033643.1.76553 ENSBTAP00000049744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]