SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049801 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049801
Domain Number 1 Region: 351-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000207
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 2 Region: 287-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000049801
Domain Number - Region: 127-185
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.068
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049801   Gene: ENSBTAG00000022635   Transcript: ENSBTAT00000052357
Sequence length 470
Comment pep:known chromosome:UMD3.1:22:51456200:51470441:1 gene:ENSBTAG00000022635 transcript:ENSBTAT00000052357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWVAAGGRGRDLPGQPGPWQLHLGLLLSVLVTALAQAPAPDVPSCSRGSCYPATGDLLV
GRADRLTASSTCGLRGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFA
PQRRAAWWQSENGVPMVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWRVYR
YFSYDCAADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSPRI
QNLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASQCAPAP
GAPAHAEGMVHGACVCKHNTRGLNCEQCQDFYHDLPWHPAEDRHSHACKKCECHGHAHSC
HFDMAIYLASGNVSGGVCDGCQHNTAGRQCELCRPFFYRDPTKDLRDPAVCRSCDCDPMG
SQDGGRCDPHDDPGCAGCAGAGRATAGRGSGLVASRSRQAAAAARAGRHL
Download sequence
Identical sequences Q2KJA7
ENSBTAP00000049801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]