SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049832 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049832
Domain Number 1 Region: 118-162
Classification Level Classification E-value
Superfamily LysM domain 0.00000000602
Family LysM domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049832   Gene: ENSBTAG00000046503   Transcript: ENSBTAT00000052586
Sequence length 404
Comment pep:novel chromosome:UMD3.1:9:25723682:25766095:-1 gene:ENSBTAG00000046503 transcript:ENSBTAT00000052586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDAQGSKGSRRFSYFFLLTLRLKKKKQAKQNAETASAMAARTHSGKEDASKVILEQDKCN
IAVEEEYITDEKKKRKSNQLKEIRRTELKRYYSIDDNPNKTHDKKEKKMVVQKPHGTMEY
TAGSQDTLNSIALKFNITPNKLVELNKLFTHTIVPGQVLFVPDANFPSSTLRLSSSSPGA
TVSPSSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVV
GGVMIVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSP
GEWEDLASEKDINPFSKFKSLNKEKRQQIGERTITSDSTSTGPSEKSTEYIETKPSDSSV
SDRVKKLESSAEATQQSTPVANVSKEPSDTAFESIAKENSLLGE
Download sequence
Identical sequences F1MP72
ENSBTAP00000049832 ENSBTAP00000049832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]