SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049967 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049967
Domain Number 1 Region: 142-464
Classification Level Classification E-value
Superfamily L domain-like 4.35e-63
Family Internalin LRR domain 0.06
Further Details:      
 
Domain Number 2 Region: 25-188
Classification Level Classification E-value
Superfamily L domain-like 1.26e-26
Family Ngr ectodomain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049967   Gene: ENSBTAG00000038600   Transcript: ENSBTAT00000052188
Sequence length 584
Comment pep:known_by_projection chromosome:UMD3.1:1:73785484:73787238:1 gene:ENSBTAG00000038600 transcript:ENSBTAT00000052188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPKHYLLLLVGCQAWAAGLAFYGCPSECTCSRASQVECTGARIAVVPTPLPWNAMSLQI
LNTHITELNESPFLNISALIALRIEKNELAHIAPGAFRSLGSLRYLSLANNKLQILPVGL
FQGLDNLESLLLSSNQLVQIQPAHFTHFSNLKELQLHGNHLEYIPDGVFDHLVGLTKLNL
GKNSLTHLSPRVFQRLSNLQVLRLYENRLSDIPMGCFDGLSNLQELALQQNQIGMLSPGL
FHNNRNLQKLYLSNNHISQLPPGIFLHLPQLNRLTLFGNSLKELSPGIFGPMHNLRELWL
YDNHITSLPDNVFSSLSQLQVLILSRNQISYISPDAFNGLVELRELSLHTNALQELDGSI
FRMLVNLQNISLQNNRLRQLPGNLFANVNNLLTIQLQNNQLENLPLGIFDHLGKLCELRL
YDNPWRCDSDILPLHNWLLLNKARLGTDSVPVCFSPASVRGQSLIIININVVVPSVQGSV
VPEVPSYPGTPTYPDTSSYPDTTSISSTTDFTSPSQDYTDLTTIETPISRGPGDMPQAQR
GLAIAAIVIGIIALACSLAACICCCCCKKRSHAVLMQMKAPNEC
Download sequence
Identical sequences F1MMI6
XP_003581764.1.59421 XP_003585707.1.76553 XP_010799563.1.76553 XP_010822982.1.59421 ENSBTAP00000049967 ENSBTAP00000049967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]