SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049986 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049986
Domain Number 1 Region: 297-456
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-37
Family SPRY domain 0.00032
Further Details:      
 
Domain Number 2 Region: 7-79
Classification Level Classification E-value
Superfamily RING/U-box 1.17e-18
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 3 Region: 86-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000133
Family B-box zinc-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049986   Gene: ENSBTAG00000039825   Transcript: ENSBTAT00000057203
Sequence length 456
Comment pep:novel chromosome:UMD3.1:29:5883517:5892565:-1 gene:ENSBTAG00000039825 transcript:ENSBTAT00000057203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDTLEAFQSELTCSICMNCFLDPVTIDCGHSFCRPCLSLCWEEGQTPRSCPECRGIAE
SPDFQTNIVLKRLASLARQSRADHDHSSEEQICVTHQEAKGLFCKADQTLLCGPCSEHPE
HTAHSHRPINRAAEESREKLLNRMDYLWGMREKVQLILTQEAKKAWSFKKFVALRKEMIK
LEYQRMHPVLQGEEQLHLEALEQEANEICHQLKESVFRMSQYRESLKETYGELTELCHKP
DMELLQALGNVLEMTDLVEMQKPQSVNPELTCWPVTGILDTLNNFRVDLRCFYMLLLLDN
VLHQKMSFHNVSLSEDNTSLIFGDDDHGVSRKLQGGESFVAWGARAFTSGRHYWEADVTQ
SFNWILGVCKNILTSDTSISIDSEEAFLLFSVNVNDHYSLFTNTRPSVQYVKRPLGRIGV
FLDYDNGAVSFYDVFRSSLIYSFLPSSISSPLKPFL
Download sequence
Identical sequences F1MMG4
ENSBTAP00000049986 ENSBTAP00000049986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]